CAZyme Information: MGYG000001131_02195

Basic Information

• Species: Prevotella sp900543585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543585
• CAZyme ID: MGYG000001131_02195
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		30456.9	7.8631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001131	3153631	MAG	China	Asia

• Gene Location: Start: 115403; End: 116185 Strand: -

Full Sequence      

MQTPIKIHMEDKQIPKKIHFVWLSGDPYPAKIRRCMETWQRVMPDYEIKQWNTQNFDIQS
APAYVQQAYAQRKWAFAADYIRMYALYHEGGIYLDSDVVILKPFDDFLKYNFFSSMEYHP
TQVERMGSRDMIDAEGHRIKDGYVSGIQIQAAVMGAQAGCEFVKDVLDDYEHRSFTMPDG
TQGQGILSPFIYARVMEKYGFLYVDRDQPLRDNMMIFRSEIFAGNKHEVTPASYAIHYCA
HSWKPALWQRLKAKLKGAFR

Enzyme Prediction     

No EC number prediction in MGYG000001131_02195.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	32	109	2.9e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.65e-17	11	244	79	280	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.93e-13	29	113	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.29e-04	12	114	44	151	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	2.72e-04	52	132	153	222	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.001	16	51	1	35	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB74226.1	9.82e-136	14	256	2	244
QUB58624.1	2.81e-135	14	256	2	244
QUB56028.1	2.81e-135	14	256	2	244
QUB65415.1	3.99e-135	14	256	2	244
ADK96032.1	3.99e-135	14	256	2	244

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001131_02195.