CAZyme Information: MGYG000001132_00702

Basic Information

• Species: UBA1685 sp002320595
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UBA1685; UBA1685 sp002320595
• CAZyme ID: MGYG000001132_00702
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		54486.51	8.0907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001132	2773330	MAG	China	Asia

• Gene Location: Start: 124391; End: 125887 Strand: +

Full Sequence      

MRTLRRGDRGEDVKVLQRALKRAGYDAGTIDGIFGPRTEAAVRAFQRANGLTVDGIVGPR
TWAALAPYMEVEESWLRKGDRGPEVQMLQLALERAGFSPGALDGIFGTRTDAAVRAFQRA
NGLQADGIVGPRTLAALKPYLTGYVEYTVKRGDTLSSIARRYGTTVQALLTANPRTNPNL
IYVGETLIIPLPFDVVPTNIAYTSELVELINEGLAARYPFITLTTVGNSVTGSPIQALEM
GTGTRHVFYNASHHANEWITTPLLLKYLEDYADAYATGGRIGGVAASRLYTGTMLHIVPL
VNPDGVDLVTGAINSGGYYQNARTLAANYPSIPFPSGWKANIRGVDLNSNYPADWEKERD
IKFAQGYTKPGPRDYVGPSALSEPESRAMYDYTRANNFALTLSYHTQGRVIFWKYQDYEP
ENAYAIGQRMAAASGYALQAGPANSYAGYRDWFIQTYNRPGYTIEAGLGTNPLPISQFNT
IYRDNVGILTIGMDALIP

Enzyme Prediction     

No EC number prediction in MGYG000001132_00702.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	147	190	1.2e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06229	M14_Endopeptidase_I	6.97e-108	247	489	1	238	Peptidase M14 carboxypeptidase family-like domain of Endopeptidase I. Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3.4.19.11). ENP1 is a member of the M14 family of metallocarboxypeptidases (MCPs), and is classified as belonging to subfamily C. However it has an exceptional type of activity of hydrolyzing the gamma-D-Glu-(L)meso-diaminopimelic acid (gamma-D-Glu-Dap) bond of L-Ala-gamma-D-Glu-(L)meso-diaminopimelic acid and L-Ala-gamma-D-Glu-(L)meso-diaminopimelic acid(L)-D-Ala peptides. ENP1 has a different substrate specificity and cellular role than MpaA (MpaA does not belong to this group). ENP1 hydrolyzes the gamma-D-Glu-Dap bond of MurNAc-tripeptide and MurNAc-tetrapeptide, as well as the amide bond of free tripeptide and tetrapeptide. ENP1 is active on spore cortex peptidoglycan, and is produced at stage IV of sporulation in forespore and spore integuments.
smart00631	Zn_pept	1.73e-46	204	482	5	277	Zn_pept domain.
cd00596	Peptidase_M14_like	1.34e-39	247	489	1	216	M14 family of metallocarboxypeptidases and related proteins. The M14 family of metallocarboxypeptidases (MCPs), also known as funnelins, are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavage. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.
cd03859	M14_CPT	1.71e-36	205	486	9	289	Peptidase M14 Carboxypeptidase T subfamily. Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPT has moderate similarity to CPA and CPB, and exhibits dual-substrate specificity by cleaving C-terminal hydrophobic amino acid residues like CPA and C-terminal positively charged residues like CPB. CPA and CPB are M14 family peptidases but do not belong to this CPT group. The substrate specificity difference between CPT and CPA and CPB is ascribed to a few amino acid substitutions at the substrate-binding pocket while the spatial organization of the binding site remains the same as in all Zn-CPs. CPT has increased thermal stability in presence of Ca2+ ions, and two disulfide bridges which give an additional stabilization factor.
COG3409	PGRP	1.25e-30	1	137	36	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT55181.1	2.50e-184	76	493	4	423
VCV21589.1	3.90e-149	74	496	2	439
CDZ24839.1	4.07e-147	79	492	7	420
AUS95891.1	6.82e-146	79	492	7	420
AOT72143.1	1.73e-143	79	492	7	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PRT_A	1.32e-10	204	465	13	277	Mutantof the Carboxypeptidase T [Thermoactinomyces vulgaris]
4IAV_A	1.35e-10	204	465	13	277	G215S,A251G, T257A, D260G, T262D mutant of carboxypeptidase T from Thermoactinomyces vulgaris with N-Sulfamoyl-L-phenylalanine [Thermoactinomyces vulgaris],4IHM_A G215S, A251G, T257A, D260G, T262D mutant of carboxypeptidase T from Thermoactinomyces vulgaris [Thermoactinomyces vulgaris],4IK2_A G215S, A251G, T257A, D260G, T262D mutant of carboxypeptidase T from Thermoactinomyces vulgaris with N-BOC-L-Leu [Thermoactinomyces vulgaris]
6F6Q_A	3.15e-10	204	415	13	214	CarboxypeptidaseT mutant L254N with Sulphamoil Arginine [Thermoactinomyces vulgaris],6F75_A Carboxypeptidase T mutant L254N with Sulphamoil Leucine [Thermoactinomyces vulgaris],6Q4L_A Carboxypeptidase T mutant L254N with with N-sulfamoyl-L-glutamic acid [Thermoactinomyces vulgaris],6Z28_A Carboxypeptidase T mutant L254N with N-sulfamoyl-L-glutamic acid [Thermoactinomyces vulgaris],7ARU_A L254N mutant of carboxypeptidase T from Thermoactinomyces vulgaris N-sulfamoyl-L-valine [Thermoactinomyces vulgaris]
3QNV_A	3.15e-10	204	415	13	214	CarboxypeptidaseT [Thermoactinomyces vulgaris],4DJL_A Carboxypeptidase T with N-sulfamoyl-L-phenylalanine [Thermoactinomyces vulgaris],4F8Z_A Carboxypeptidase T with Boc-Leu [Thermoactinomyces vulgaris],4GM5_A Carboxypeptidase T with Sulphamoil Arginine [Thermoactinomyces vulgaris],6GO2_A Carboxypeptidase T with N-sulfamoyl-L-Leucine [Thermoactinomyces vulgaris],6SN6_A CARBOXYPEPTIDASE T WITH N-SULFAMOYL-L-GLUTAMIC ACID [Thermoactinomyces vulgaris],6T9Y_A CARBOXYPEPTIDASE T WITH N-SULFAMOYL-L-LYSIN [Thermoactinomyces vulgaris],6TNK_A CARBOXYPEPTIDASE T WITH N-SULFAMOYL-L-VALINE [Thermoactinomyces vulgaris],7Q87_A Chain A, Carboxypeptidase T [Thermoactinomyces vulgaris]
1OBR_A	3.21e-10	204	415	13	214	CARBOXYPEPTIDASET [Thermoactinomyces vulgaris],3V7Z_A Carboxypeptidase T with GEMSA [Thermoactinomyces vulgaris],4DUK_A Carboxypeptidase T with L-BENZYLSUCCINIC ACID [Thermoactinomyces vulgaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03415	3.07e-83	214	493	122	394	Gamma-D-glutamyl-L-diamino acid endopeptidase 1 OS=Lysinibacillus sphaericus OX=1421 PE=1 SV=1
P54497	2.19e-59	202	489	84	368	Uncharacterized protein YqgT OS=Bacillus subtilis (strain 168) OX=224308 GN=yqgT PE=3 SV=1
P29068	2.73e-09	204	415	111	312	Carboxypeptidase T OS=Thermoactinomyces vulgaris OX=2026 GN=cpt PE=1 SV=1
L7N653	4.55e-09	4	137	12	160	N-acetylmuramoyl-L-alanine amidase CwlM OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cwlM PE=1 SV=1
P39800	3.49e-08	143	232	157	259	N-acetylmuramoyl-L-alanine amidase XlyA OS=Bacillus subtilis (strain 168) OX=224308 GN=xlyA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001132_00702.