CAZyme Information: MGYG000001132_01651

Basic Information

• Species: UBA1685 sp002320595
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UBA1685; UBA1685 sp002320595
• CAZyme ID: MGYG000001132_01651
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000001132_27|CGC2	24247.82	8.9658

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001132	2773330	MAG	China	Asia

• Gene Location: Start: 123364; End: 124029 Strand: +

Full Sequence      

MMVVPGKASGKKRGTGATRSAAAKKKRKQSARARALRTAGIALLSVVLLSVGAYFLNIRM
EKNTYRLAYAEAILRESGAFGLDPCLVAAVIHCESRGQAEACSPKGARGLMQIMPATGEW
ISEKLALTSFTEDALYEADVNIRFGCWYLSYLLEKYDGEKDLALAAYNAGPGNVKKWLED
PAYSENGRLTAIPFSETEAYVKRVNAASEKYRELYEEELAQ

Enzyme Prediction     

No EC number prediction in MGYG000001132_01651.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	84	211	2.7e-28	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.72e-75	67	210	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.35e-50	65	214	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.72e-40	84	207	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.41e-29	65	221	135	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.40e-26	73	178	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT54455.1	6.34e-51	41	215	31	206
AYH39946.1	1.21e-50	43	216	23	195
VTQ87399.1	3.40e-46	41	215	8	183
ACL76418.1	6.16e-45	40	216	16	192
ARC85089.1	6.47e-45	44	216	10	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.62e-23	61	215	404	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.65e-23	61	215	408	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.69e-23	61	215	414	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.71e-23	61	215	418	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.75e-23	61	215	424	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.10e-18	71	206	62	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	3.58e-18	62	212	473	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	5.91e-18	63	206	1416	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	5.91e-18	63	206	1416	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P0AGC4	8.94e-18	62	212	473	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999871	0.000150	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
35	57