CAZyme Information: MGYG000001145_00433

Basic Information

• Species: TM7x sp900556355
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; TM7x; TM7x sp900556355
• CAZyme ID: MGYG000001145_00433
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000001145_7|CGC2	38082.99	9.8708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001145	729391	MAG	China	Asia

• Gene Location: Start: 46200; End: 47213 Strand: +

Full Sequence      

MNRLAIIVLNWNGSDDAIECVDSLIKQTLKPTIVIVDNNSSDDSVAVFEEYISSHKKEKI
ILLKNSDNLGFAGGINTGLIYALKNNFEYIGVLNPDAIADKNWCESLTYQLSKYPQCGIV
TGILQRRDGKTLDTTGDFYTTWGLPGPRNRDEPIKNAPAKSGEIFGATGGGAIYRAKIFD
NIDMFDEDFFMYYEDVDLSFRAQLAGWKVRFTPKAIAYHKVGASSKKVPGLAVYNTFKNL
PLVFIKNVPGKLFWYIGIRFLLTYWLIFASAIRHGNGWPAFKGALVSIIHKPAAYKKRFY
IQKNRKVSVDYIRNIIHDGPLPNQTGLLKFKHFFRIK

Enzyme Prediction     

No EC number prediction in MGYG000001145_00433.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	181	2.4e-21	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	3.28e-55	1	292	2	287	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	2.17e-48	6	221	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	3.76e-21	5	230	1	214	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd00761	Glyco_tranf_GTA_type	5.31e-19	6	211	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam13641	Glyco_tranf_2_3	1.31e-18	2	227	2	219	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA06666.1	1.17e-199	1	337	1	337
QCT41847.1	1.17e-199	1	337	1	337
QHU90825.1	2.18e-188	1	337	1	337
QJU05448.1	3.09e-188	1	337	1	337
QHU92537.1	4.39e-188	1	337	1	337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU63	3.38e-07	68	288	74	297	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P9WMY2	6.06e-07	88	229	93	245	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	6.06e-07	88	229	93	245	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001145_00433.