CAZyme Information: MGYG000001145_00740

Basic Information

• Species: TM7x sp900556355
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; TM7x; TM7x sp900556355
• CAZyme ID: MGYG000001145_00740
• CAZy Family: GT4
• CAZyme Description: Alpha-galactosylglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000001145_7|CGC4	38335.59	9.7647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001145	729391	MAG	China	Asia

• Gene Location: Start: 333434; End: 334456 Strand: +

Full Sequence      

MSKKDDKKLIVNMISESEFTVQGHGVHTAYKEITDALRKRKDIDIEVNSDRPADIIHIQT
MGLYSFRHLMKKSGKKVVSAHIVPDSFVGSIKGAKYWKPLGRAWLKFFYKKADLVLACSG
MVADELINDMHVPKTKVLYNTINMSRYKHSAAEKKSARKKLGLKDDDFVVMGNGQVQPRK
RLDILIKAAKEMPDVKFFWVGGIPFKNLGADYNAMQDMIKNAPNNLTVTGVIPLENVRDY
YVAADVFVLPAMQENHPMCVLEAAGAGLPIILRDIPQYNDTFKGDAVMAKTDDEFLELIS
ELRKDKKAYKKAQLGAEKIAERFDSSAGAERLVEFYRSLI

Enzyme Prediction     

No EC number prediction in MGYG000001145_00740.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	160	310	5.5e-20	0.9625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.56e-33	16	337	50	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.55e-29	51	340	82	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03817	GT4_UGDG-like	1.86e-28	51	336	83	372	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03798	GT4_WlbH-like	2.40e-25	45	339	88	376	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
cd03807	GT4_WbnK-like	2.05e-22	50	337	77	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA06787.1	5.12e-223	1	340	1	340
QCT41431.1	5.12e-223	1	340	1	340
QWQ32621.1	8.33e-217	1	299	1	299
QHU90270.1	1.24e-162	4	340	3	339
QJU04965.1	1.76e-162	4	340	3	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	2.97e-08	157	271	234	351	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DPV9	1.62e-47	5	336	29	365	Alpha-galactosylglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=cpoA PE=1 SV=1
Q8KQL6	5.07e-19	11	302	3	292	Processive diacylglycerol alpha-glucosyltransferase OS=Acholeplasma laidlawii OX=2148 GN=dgs PE=1 SV=1
D6Y4U7	1.14e-10	112	336	174	411	D-inositol 3-phosphate glycosyltransferase OS=Thermobispora bispora (strain ATCC 19993 / DSM 43833 / CBS 139.67 / JCM 10125 / KCTC 9307 / NBRC 14880 / R51) OX=469371 GN=mshA PE=3 SV=1
O32272	5.87e-10	112	282	165	323	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1
B1MHQ0	6.71e-10	111	271	182	343	D-inositol 3-phosphate glycosyltransferase OS=Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) OX=561007 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001145_00740.