CAZyme Information: MGYG000001148_00226

Basic Information

• Species: Fusobacterium_A varium_A
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A varium_A
• CAZyme ID: MGYG000001148_00226
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000001148_21|CGC1	33441.95	9.4054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001148	3218254	MAG	China	Asia

• Gene Location: Start: 22; End: 882 Strand: +

Full Sequence      

MRDYFQCEVLLIIWDIFPQNAIDLGIIKNKFLIKYFDSKYKKALKISDYITVMSEGNKKY
IKNIFRIEDKKIILLKNWAYIKPKLDMDKEEIRKKYGYSEEDFLAIFGGNMGKPQKLENI
LSLAEKCLELPDVKFIFVGNGSERERLKKIAIDKRLKNIRFVDQLPREDYEKFTSTCNIG
LVSLDERFTVPNFPSKTTDYFKLSLPILASLDKCSAADYGKFLEEEAKGGIFAEAGNVED
LYKKFLTLYNSKDLRKQLGNNGREYYEKYLGVDKAYKTIMNIIKKD

Enzyme Prediction     

No EC number prediction in MGYG000001148_00226.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	1.37e-65	4	280	121	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	1.41e-20	7	284	106	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
PRK10307	PRK10307	6.27e-20	70	273	194	395	colanic acid biosynthesis glycosyltransferase WcaI.
COG0438	RfaB	1.35e-13	9	285	113	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03817	GT4_UGDG-like	2.27e-12	26	279	126	368	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBA50414.1	2.58e-207	1	286	115	400
AVQ31572.1	1.19e-182	1	286	115	400
SQJ09774.1	4.04e-163	1	286	118	404
AVQ27007.1	4.04e-163	1	286	118	404
QNM14784.1	5.03e-126	4	281	120	398

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58577	8.32e-12	17	279	93	349	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1
P32057	1.68e-07	72	284	198	406	Putative colanic acid biosynthesis glycosyl transferase WcaI OS=Escherichia coli (strain K12) OX=83333 GN=wcaI PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001148_00226.