CAZyme Information: MGYG000001148_02738

Basic Information

• Species: Fusobacterium_A varium_A
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A varium_A
• CAZyme ID: MGYG000001148_02738
• CAZy Family: GT4
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		41626.2	9.2251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001148	3218254	MAG	China	Asia

• Gene Location: Start: 443; End: 1525 Strand: +

Full Sequence      

MKILHIVESFGGGVYDFIKDFTGITPEYQHTILYGKREGLKDNFKNDFKENVDFILWKNA
KREISIRNDFLALKELLNLLKKEKFDIIHLHSSKAGFLGRVAARAYNQQNKVIYTTHGIS
FLRKDISNRKLQLYIFLEKIGSLCGGKTIACSKSEAEFIQSKGIKCSYINNGIKLKNKGI
KTEKKEDKELKIVTVGRITIQKNPKLFNEIAENFIENKNMKFIWIGDGELREQLSSENIE
ITGWLNQEEVQKQLIEADIYLSTASWEGLPLAVLQAMENSLPLLLSDCVGNINLVEEDYN
GFLFKTKEEAIEKINFLIKDKEKIKELGENSYLLLKKEFDIQNMDGKYKTLYKQLERNKK

Enzyme Prediction     

No EC number prediction in MGYG000001148_02738.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	185	328	4.7e-20	0.9625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	3.98e-56	2	349	1	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03801	GT4_PimA-like	9.65e-42	2	353	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.31e-32	1	359	1	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03807	GT4_WbnK-like	1.03e-23	86	353	81	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
pfam00534	Glycos_transf_1	5.66e-22	188	332	1	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ44961.1	7.73e-111	1	355	6	364
AXE16417.1	1.01e-103	1	358	1	353
QTR44868.1	1.08e-103	1	352	1	353
QQZ28399.1	1.59e-102	1	352	1	353
QTX11320.1	2.20e-98	1	352	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XYW_A	2.07e-13	69	351	63	335	GlycosyltransferasesWbnH [Escherichia coli]
6EJJ_A	2.10e-06	187	351	181	353	Structureof a glycosyltransferase / state 2 [Campylobacter jejuni],6EJJ_B Structure of a glycosyltransferase / state 2 [Campylobacter jejuni]
6EJI_A	4.94e-06	187	351	181	353	Structureof a glycosyltransferase [Campylobacter jejuni],6EJI_B Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_A Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_B Structure of a glycosyltransferase [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48453	2.92e-20	1	353	1	356	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
P0DMP6	4.65e-13	69	351	63	335	O-antigen biosynthesis glycosyltransferase WbnH OS=Escherichia coli OX=562 GN=wbnH PE=1 SV=1
P0DMP7	4.65e-13	69	351	63	335	Probable O-antigen biosynthesis glycosyltransferase WbiN OS=Escherichia coli OX=562 GN=wbiN PE=3 SV=1
Q0P9C9	4.98e-09	68	331	62	349	N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglA PE=1 SV=1
Q8S4F6	8.75e-09	76	322	181	447	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001148_02738.