CAZyme Information: MGYG000001148_02999

Basic Information

• Species: Fusobacterium_A varium_A
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A varium_A
• CAZyme ID: MGYG000001148_02999
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
172		19505.96	8.8481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001148	3218254	MAG	China	Asia

• Gene Location: Start: 31; End: 549 Strand: +

Full Sequence      

MLEKYQGKKLILLAPGSKWFTKKWPLEYFNEVIGQVMNREDIVTGIIGGAEELTLNIVTG
GNVVDFRGKTTLLELAELIKRSELVVTNDSSPIHIASAWKNVKILAIFGPTVKRLGFFPW
SENSKVFETENLTCRPCSLHGGDKCPQRHFKCMLEIKPKMILDEIMKTIERV

Enzyme Prediction     

No EC number prediction in MGYG000001148_02999.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	6	150	5.3e-33	0.6088888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.43e-39	2	167	114	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.68e-30	3	170	170	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	4.18e-18	7	137	104	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	3.45e-16	8	164	174	328	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	1.78e-08	7	127	182	306	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBA49817.1	1.49e-123	1	172	165	336
VEH40950.1	1.19e-111	1	171	168	338
AVQ30469.1	1.19e-111	1	171	168	338
AVQ27559.1	2.61e-108	1	172	168	339
SQJ15113.1	2.61e-108	1	172	168	339

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	7.37e-07	8	165	180	340	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001148_02999.