CAZyme Information: MGYG000001149_00841

Basic Information

• Species: Fusobacterium_B sp900554355
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900554355
• CAZyme ID: MGYG000001149_00841
• CAZy Family: PL8
• CAZyme Description: Xanthan lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	MGYG000001149_19|CGC1	78190.93	6.0849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001149	1411115	MAG	China	Asia

• Gene Location: Start: 77737; End: 79734 Strand: -

Full Sequence      

MMERTVMLDRRKEYLAGAEKIPQETLDFLNKELKRILSEKFDYSEIGKDINLLKKFYKDT
LTLAKGYTVKGTEYEKNADVLKLVEERLSMGQKYFYNKNCAEHTNWWVWEIDIPMLLNDI
FVLMNEDISKDIMKEVMDSGRYFQPDPRYSGNNEGAIYTTKLPLRFSTAEHRAETVKVSL
IRGILENNKDEIKLALNSLIEAWAYKDDSYSLDRNGFYRDGSFLHHGSIPYTAKYGNIIL
REIGEIIHLVRKTEYEKYLLGLKNFYDIIFTSFEPFFFKGGFTDMLNGRGISDYTSHDHK
TGHEMLNSLLLIKEDAPEEYKSKLAELIKSEVEKDTFYKYFENEKSPFFYNHMKELLEEN
IEIKEYKDRLVICNKMNRIMRRAENYAVGIAMHSSNIGNYETRNGENIKGWYTGDGAYYL
YDNDLEQYKDYWKNVDYNYIPGTTEIRMNMENVDAQRNPEHKPLDRKSAAGLKWHYYGAA
GMEFENWNGNLTSRKSWVFVSWGVIFAESCIKGKGEVYTTIANRKFKEVPEIKVDGKILD
EERAVLKADNVEINGKIFMFYKKTEINIEIEKKEDCCFVKMWVEHGENPVNSSLVWGLVM
NKGNMSLDEIREKFGVKITEGKHLINGIQCNYEINWDSKVKVEPFCTVYRKEDNRESRIY
LNNNY

Enzyme Prediction     

No EC number prediction in MGYG000001149_00841.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	374	599	2.1e-43	0.9575289575289575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.34e-108	61	602	71	619	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam08124	Lyase_8_N	7.72e-62	12	330	19	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02278	Lyase_8	2.03e-41	374	599	5	248	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ18397.1	3.17e-190	1	663	5	662
QNM15126.1	5.24e-182	7	661	7	656
ACZ00610.1	8.32e-125	7	626	4	608
AVL42978.1	8.32e-125	7	626	4	608
QXW65378.1	1.41e-103	124	626	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1N7O_A	1.68e-54	24	568	42	585	ChainA, hyaluronidase [Streptococcus pneumoniae]
1OJM_A	2.54e-54	24	568	42	585	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With Unsulphated Chondroitin Disaccharide [Streptococcus pneumoniae]
1C82_A	2.60e-54	24	568	44	587	MechanismOf Hyaluronan Binding And Degradation: Structure Of Streptococcus Pneumoniae Hyaluronate Lyase In Complex With Hyaluronic Acid Disaccharide At 1.7 A Resolution [Streptococcus pneumoniae],1EGU_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase At 1.56 A Resolution [Streptococcus pneumoniae],1F9G_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase Cocrystallized With Ascorbic Acid [Streptococcus pneumoniae],1OJP_A Specificity And Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With 6-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae],1W3Y_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin C [Streptococcus pneumoniae],2BRP_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with W249b [Streptococcus pneumoniae],2BRV_X Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 70percent saturated malonate. [Streptococcus pneumoniae],2BRW_A Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae],2BRW_B Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae]
1LOH_A	8.08e-54	24	568	42	585	ChainA, Hyaluronate Lyase [Streptococcus pneumoniae],1LXK_A Chain A, Hyaluronate Lyase [Streptococcus pneumoniae]
1OJN_A	9.10e-54	24	568	44	587	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex Of The Tyr408phe Mutant With 6-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59801	8.05e-53	96	568	171	634	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q53591	2.71e-51	16	595	274	873	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q54873	4.57e-51	57	568	359	871	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q9AQS0	4.28e-47	57	525	97	541	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001149_00841.