CAZyme Information: MGYG000001151_00067

Basic Information

• Species: Ruminococcus_C sp000433635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000433635
• CAZyme ID: MGYG000001151_00067
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820		90071.45	4.1411

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001151	2508735	MAG	China	Asia

• Gene Location: Start: 4584; End: 7046 Strand: -

Full Sequence      

MKIKKKVFAASLAAAMALNAVCVSSFFGGVSAAGETKYEFEDGKITGVSAEVEEVASASG
GKVVHMRDAGETIKVTVNVEKAGMYDLNICYATDGGAKTQKLNVNGNAAGDLALSNHTDF
SESNVARIKLNAGENELEFVSYWGWTQFDYFTLTEPNYPTLSATSDLSDKNATPETQSLM
NYLASVYGEHIISGQQEIYNGGPHDFEYEFNYIKDTTGKSPAIRGFDFLNTNPLYGSEDG
TVDRMISWVKDSKGIVTASWHITVPKKFSDYNIGDKVDWANGTYKPDETDFDTAKVLEEG
TKEREYYMLCLKMLAEQIQKLQDAGVPMIFRPLHEAEGGGGEDGSWFWWGKSGSAVYKDL
WKLTYKTLTEDYGLHNMIWEWNSYTFDTSTNWYPGDEYVDLVAYDKYNCTDWSTGNAVLV
HNDSAIGGTFYSLVEQYGGKKMVAMAENDSIPTLENLQMEKAGWLYFCPWYDGGSDSTNF
LSNEMFNKKEDLKEIYTSDYCITLDELPENLYSNSGAVITTTSGTGQTTTTTTTTTTTTT
MTTTKIENAIMGDIKKDGSTVKVIFDRSMGKEVHLIVDLDDSLGYANGCVGVSVKVDGVD
YWVSYKWEASKSDDVTVSLDADNVYNVTFNNGSGTVKDADQIAKIAEAAQKEKEAQFQVW
WANDKEGEKDDTTKATLVAAYLPDESGETTETTVTTTDAGTTTTPEETTTEPVESTTTSA
EVTTAPNETTTTVTTAATTGSESEALYGDINMDGKVDLTDAVMLNKHQAGLVTLTDVQKV
NANCDITDGTENITEEDSFALMRFILMMEGYENLPHNSAK

Enzyme Prediction     

No EC number prediction in MGYG000001151_00067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	168	506	3.6e-93	0.9966996699669967
CBM78	556	684	1.8e-51	0.9923076923076923
CBM35	38	153	2.1e-25	0.9915966386554622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.62e-48	169	506	2	311	Glycosyl hydrolase family 26.
cd04086	CBM35_mannanase-like	1.90e-34	36	154	1	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
pfam16990	CBM_35	1.96e-16	38	153	2	117	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
cd14256	Dockerin_I	1.19e-09	747	806	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd02795	CBM6-CBM35-CBM36_like	1.54e-08	37	153	1	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCZ84116.1	0.0	1	820	1	820
ERJ92224.1	6.89e-289	5	817	11	849
CDE12720.1	4.79e-283	2	806	3	828
CDE29814.1	1.09e-206	5	806	6	821
ADU21037.1	1.63e-146	70	517	72	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.26e-68	34	507	11	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6D2X_A	5.10e-42	167	510	4	337	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6HPF_A	6.13e-41	163	507	3	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6HF2_A	4.24e-40	166	472	44	316	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2W_A	2.29e-39	167	510	95	428	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	6.04e-69	36	507	42	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55297	8.47e-65	38	508	24	462	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	1.01e-62	38	508	23	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55296	3.21e-59	38	508	24	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P49425	5.87e-52	33	509	14	459	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000680	0.770501	0.227779	0.000481	0.000300	0.000226

TMHMM  Annotations     

start	end
7	29