CAZyme Information: MGYG000001154_00586

Basic Information

• Species: CAG-1427 sp000431675
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp000431675
• CAZyme ID: MGYG000001154_00586
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833	MGYG000001154_6|CGC2	94204.87	4.8391

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001154	1843166	MAG	Austria	Europe

• Gene Location: Start: 99810; End: 102311 Strand: +

Full Sequence      

MNVSFKTIRRSGDKVYILSEISDYDERLPVVLSASTESGALIPSDTFPYCDINDAFALRD
VLYDGSLANQGMALPPLHTKNSAGVRFFVISLPWLEVKRWDLVFRAIDASGTVVSSCRKS
LDPLTTSIKALASQRTSPETGEMIEDLEGRFVHDRIHVSFIRAVEIEDNYRISALIEMPY
REETRVECDFLDSHGKPLSLEYRVVEDSIAQPPEYGSIRRRYMIVSFLVDKQSPYLCLCA
TDTQGTISPGFAVLGTKTLETLNARFCDRTTSAYNDPEYHTWFVEHHRADVPALLEQVAT
RFENEPLFSIVCLLTDDPDHHIYDFVNSVAQQSYGRWELIMVDMLGTKGRVSDLKELLDD
DRFYIIDADPSVGIDENFDAGMAAAEGDFILFTKVRDVLAPDALFEFVRVINEYPDCDFL
YSDVDTCDAQGIHSQPLFRPDFSPELLRSYNYIRDLVVMRESLYAEISPLSYSMFSASGY
ELVLRATEKARRVCHVPRVLCHRRFATVEPPDAMVSRIEQEVGRKALVAHCQRLGLKAEV
LNEDVAGHYRVRHVLVDHPHVVIVVSYEGDPALLQTCVKSLYDKITYQNFEIVVVDAGSH
AEADQECFDALRDQYDTFSVLSWNEPINRPKMANFAAQQTKGEFLLFVNGDARILSDDAI
EVLLGYFQSPNVGIVGPKQLFVDGTIEHAGIVVGGTRVVTPLFRHLPSSWHGYLDRARVA
QNVSAVTGECMMIRRSAYDEVGGFSEELALFYGDVDFCLKIRNAGYLTVYTPFVELCHLK
SATRLRIHSKELRIKRRREMAYLQSAWPEVFIEGDAFGNPNLDPDSSYFALKQ

Enzyme Prediction     

No EC number prediction in MGYG000001154_00586.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	561	783	1.3e-20	0.9173913043478261

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.32e-50	306	504	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	4.70e-33	562	779	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.00e-20	562	798	7	240	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	9.10e-16	326	504	17	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1215	BcsA	1.34e-13	562	772	58	258	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV56006.1	2.39e-158	1	831	1	829
QOY61387.1	1.27e-118	3	831	4	809
ACV56016.1	1.02e-115	86	828	43	788
ATP53720.1	2.08e-115	81	831	67	823
AZH69456.1	3.19e-113	88	831	74	823

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.63e-72	295	831	355	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	6.59e-71	278	784	292	798	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	7.48e-10	562	781	7	238	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	7.48e-10	562	781	7	238	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
D4GU63	1.03e-07	562	789	22	234	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001154_00586.