CAZyme Information: MGYG000001156_02109

Basic Information

• Species: SFHK01 sp004556395
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; SFHK01; SFHK01 sp004556395
• CAZyme ID: MGYG000001156_02109
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000001156_109|CGC1	41572.85	5.1413

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001156	2933732	MAG	Austria	Europe

• Gene Location: Start: 16035; End: 17123 Strand: +

Full Sequence      

MKFDRNQLLTLSRKILDGIMDENNQESFTSRDGHHYMYNWDWFQGVALFGIYRYWRETGE
QAAFDYLIKWFDEHIERGLPGKNVNSMSPCLTLSFLWEHTGNEKYLEICREWAEYAMYKL
PRTTEGGIQHVTIDSDNYQQLWDDTLYMTVLFLSRMGRLLKKDEYVQESAKQFLVHVKYL
SDLKTGLFFHGWSFESNDHFAGALWGRGNAWYTAGLVDYLDLAEIPACVRDFLVSALDRQ
TEALERYQDADGFWHTLIDHMEDSYAESSATAGFAYGIMKAARLGYIPASRLEMGRRGLA
AVLSQIDEKGIVHGVSAGTCLRGSLDYYRGIRLSAQPYGQSMALLAITEALSQEGSDTVK
KE

Enzyme Prediction     

No EC number prediction in MGYG000001156_02109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	34	350	1.5e-98	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.24e-105	8	352	8	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.99e-91	40	351	27	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ98394.1	9.03e-127	9	351	16	351
QUL58446.1	5.56e-123	14	351	15	351
SDS22765.1	1.87e-122	37	354	38	354
AIQ43751.1	2.96e-120	14	351	15	351
QYR23849.1	1.05e-114	37	354	20	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	5.22e-95	5	351	24	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	2.29e-93	5	351	23	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	6.02e-83	38	349	45	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	1.08e-23	39	349	22	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	5.05e-17	141	339	199	401	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	5.40e-60	40	351	29	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	2.29e-14	148	328	1	205	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.29e-14	148	328	1	205	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000021	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001156_02109.