CAZyme Information: MGYG000001157_02441

Basic Information

• Species: Gemmiger sp900540775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900540775
• CAZyme ID: MGYG000001157_02441
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000001157_122|CGC1	46347.71	5.3351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001157	2792015	MAG	Austria	Europe

• Gene Location: Start: 24404; End: 25621 Strand: +

Full Sequence      

MLYERYLRAYAEQFRKTDRNMWNYEDGCVLVGLRALYQVTGDAFYFDVLNSFMERYIEPD
GTIRRYVAEEYNLDYIQAGCALYTLYDETGESRYRKAIETLEEQLRHQPRTPCGSFWHKG
IYPNQVWLDGLYMGLPFHAAYALRFGDAATLDDIMLQFRNARKYLYDGKTGLYYHAWNET
KDVFWADPKTGLSQNFWTRAIGWYLMAMADIYAMLPDSRADLQKELAALWKEAIDGMLRW
QEPDSGLFYQLPALPDVRGNYLETSGSLMVAYSLLKGARLGVLAEPKYRTAGEKILVGIE
LRQFTVHDGKVELHGICKGAGLGPAGNLRRNGTVEYYLSEDVVHDEQKGVGVCMMAYAEY
LQAKQAGALTDDFPKVEIFNKGYDPIMSGDPAFIAFEKNRVGKTG

Enzyme Prediction     

No EC number prediction in MGYG000001157_02441.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	15	361	2.3e-103	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.69e-90	5	363	10	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.57e-74	16	361	21	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ15312.1	1.42e-169	1	403	1	397
QTQ12711.1	1.65e-168	1	403	1	397
QTQ13070.1	1.65e-168	1	403	1	397
QJU19057.1	3.05e-127	1	360	1	358
ASN96698.1	6.06e-127	1	360	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.29e-93	11	360	14	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.37e-66	20	359	37	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.83e-65	20	359	27	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	1.06e-14	22	299	47	320	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.39e-65	20	359	37	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.96e-39	133	361	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.96e-39	133	361	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	5.35e-16	22	280	29	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001157_02441.