CAZyme Information: MGYG000001159_00794

Basic Information

• Species: Bifidobacterium pullorum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium pullorum
• CAZyme ID: MGYG000001159_00794
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000001159_28|CGC1	43681.72	10.0298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001159	2232439	MAG	Austria	Europe

• Gene Location: Start: 22052; End: 23206 Strand: -

Full Sequence      

MALGFDEPIRGVNLGNWLVLERWMTPGLFRTSGEADEIWMHRTMPSDALDRLLRRHRETY
VTLDDFRAIAAHGCNLVRIPVPYFIFGDVPGHPGCVGFLDRAFDWANATGLKVLIDLHTV
PGSQNGYDNGGLTGVCRWHRSPKAVGFALDVLTRLAARYRDDPALFGIEVLNEPVSWLVY
RTAASTGAARDAAEARGSGHVPMRFLKAFYRESYRRLRGVLRPEAVIMFHDGFRLGAWGD
WFVREGMRNVMLDTHIYLVGFDAFCPVHAMWAYRAYLRWSERRIRRAARHTPVVVGEWSL
ANATAGRAAGRAEPSERQSAEDRIYRDLAAMQRRTWDAGAGHIFWSYQLRRLRDGSGPRP
GREPWSLSDAWRNGWISGLNAERR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	55	348	1.4e-130	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.42e-25	6	174	15	191	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	3.80e-06	56	174	20	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAY33793.1	4.14e-286	1	384	13	396
QOL34533.1	2.08e-187	1	381	3	396
QSG89102.1	2.21e-178	2	376	5	400
VEG79919.1	2.21e-178	2	376	5	400
CBK69899.1	3.14e-178	2	376	5	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.36e-84	9	378	3	388	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.87e-83	9	378	3	388	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	3.63e-37	6	259	6	251	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	3.97e-37	6	259	11	256	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.35e-36	6	259	6	251	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CRV0	1.98e-43	6	299	39	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
Q5B5X8	2.25e-43	2	374	22	388	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
B0XN12	3.92e-43	5	299	38	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q0CR35	5.46e-43	7	374	38	400	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
Q4WK60	1.48e-42	5	299	38	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001159_00794.