CAZyme Information: MGYG000001159_00996

Basic Information

• Species: Bifidobacterium pullorum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium pullorum
• CAZyme ID: MGYG000001159_00996
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000001159_30|CGC2	44649.86	4.7629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001159	2232439	MAG	Austria	Europe

• Gene Location: Start: 31834; End: 33021 Strand: -

Full Sequence      

MTAPSYTFPNDFIWGAATAAHQIEGNNVSSDWWAREHAPNTDLSEASNDACDSYNRFEED
IRLLAASGLRMYRFSVEWARIEPECGCFSKAQLLHYRRMIDTCHQYGVEPMVTLYHMTLP
LWFAEQGGWRRADAAERFRRYVEYVLPILHDVTWVCTLNEPNMVALTRGGTEGSDFTAAS
LPYPDPEISENLVTVHRSAREVLSTIPTIKSGWTIACQAFHAVPGCEAEMEAYQYPREDY
FTEAAAGDDFIGVQAYLRTFIGKDGPVPTDPNAERTLTGWEYFPPALGIAVRHTWEVGGH
TPIFVTENGIATANDARRIDYTYDALACLHDAMADGIDVRGYLHWSLLDNYEWGSFRPTF
GLIGWDKDTFERHPRPSLEWLGNVSRSGVLSHPAR

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	386	2.9e-101	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03356	BGL	2.94e-76	9	380	1	425	beta-galactosidase.
COG2723	BglB	4.23e-76	6	388	2	453	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.16e-67	7	387	4	450	Glycosyl hydrolase family 1.
PRK13511	PRK13511	7.91e-42	5	390	2	468	6-phospho-beta-galactosidase; Provisional
PLN02998	PLN02998	8.46e-39	8	394	31	493	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAY32083.1	3.54e-301	1	395	1	395
AUD87924.1	1.27e-244	1	395	1	396
AUE06074.1	1.27e-244	1	395	1	396
ABE96323.1	1.27e-244	1	395	1	396
AUD94072.1	1.27e-244	1	395	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	1.80e-106	1	386	3	410	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	2.36e-86	7	389	31	432	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
1VFF_A	8.72e-70	8	387	5	405	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6JFP_A	1.41e-57	8	394	4	449	Crystalstructure of the beta-glucosidase Bgl15 [uncultured bacterium],6JFP_B Crystal structure of the beta-glucosidase Bgl15 [uncultured bacterium]
6Z1H_A	1.11e-54	3	390	6	450	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03506	5.97e-50	6	390	4	448	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
B9K7M5	7.63e-49	8	391	4	443	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q08638	1.55e-48	8	390	6	444	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P26208	1.61e-48	7	387	5	445	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P22073	3.32e-46	6	390	4	444	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001159_00996.