CAZyme Information: MGYG000001160_01467

Basic Information

• Species: CAG-274 sp000432155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274; CAG-274; CAG-274 sp000432155
• CAZyme ID: MGYG000001160_01467
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	MGYG000001160_21|CGC1	57603.25	4.0751

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001160	2196853	MAG	Austria	Europe

• Gene Location: Start: 12295; End: 13854 Strand: -

Full Sequence      

MEIKTTAVSANRLTARENVQFLQEGDIIVPDNKPDIEKILRTSGNVVIDSTNIADGRLNY
RGHIALDCLYLSKGENKKLHTMSKDIEINDFIAISGIEENMSPKLKCTIENIDTGILNER
KINYKISGNAFADVNEVVEINAVSSIDDLSENQQKLTTIKTTKNICSKTEKINIKEEVAI
PPTKLPIDEIISIEPTLLNTEAVPSQDSVKISGDITASMLYTSNESSVPEVFDIDIPFDG
MIETEDVEPNMEINTDLTITDFYYDVSEDENGENRIVNLEFVINACIEAYATQENEILED
AYSVNNNITMENETLCYDREVCRNKSQCPVKDIVSIDNDCPAMLQIIKAVGTPYIDVISI
FDNKVVIDGVINVSILYVTGDDTMPVYCANGAVPFSQTVEARGAEEGMKADVDCVLSHIG
FNMISDREVEVRCALNTNTIVTEKICAVLATDVNIEPMDRAVIDGIAAFIIYTVQKGDTL
WKLAKRFNTTVEDILAVNDIENPDLIYPGQRLIIVKHID

Enzyme Prediction     

No EC number prediction in MGYG000001160_01467.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	472	514	1.1e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	9.60e-17	470	514	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam12673	DUF3794	3.46e-15	344	424	3	80	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.
smart00257	LysM	2.17e-14	471	514	1	44	Lysin motif.
pfam01476	LysM	3.80e-14	472	514	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
pfam12673	DUF3794	3.70e-12	35	117	1	80	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ42415.1	1.21e-80	1	516	3	517
CUH93853.1	4.97e-80	1	519	1	519
BCN28808.1	5.10e-80	1	519	1	519
QUH29051.1	3.38e-77	19	519	21	521
AEY64317.1	1.21e-76	1	516	3	519

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001160_01467.