CAZyme Information: MGYG000001160_01471

Basic Information

• Species: CAG-274 sp000432155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274; CAG-274; CAG-274 sp000432155
• CAZyme ID: MGYG000001160_01471
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000001160_21|CGC1	44324.69	4.0723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001160	2196853	MAG	Austria	Europe

• Gene Location: Start: 15755; End: 16957 Strand: -

Full Sequence      

MAQGTLAVQLTIGGAEPITSGKVVISDDTGQELYTLYTNESGKTIPVTLEAPPAEYSLGV
GEPQPYSSYNIRITADGFKDVVINGVQVFAGTEALQNVAMTAGQGEIVINIPPPVLWGDY
PEKEPEEEVKEIPPETGFVVLDRVVIPEYVVVKEGTPSGGGDVYYVPYKDYIKNVASSEI
YSTWDEAAIRANVLAIQSFVLNRVFTEWYRNKGYNFTITNSTRYDQAFNYGRTIYEDISI
IVDEMFTNYIKREGEIQPLFAQYCDGRNVVCPNWLSQWGSAALAEQGYSAMDILRYYYGN
DIYLEQAESVSGVPVSFPGENLTIGSRGNDVRTIQSQLNTISRTYSAIPRLAVDGVYGEA
TVESVKAFQNIFNMPQTGIVDLATWYQISQIYVALERLAE

Enzyme Prediction     

No EC number prediction in MGYG000001160_01471.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	7.76e-12	327	388	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	6.50e-08	310	388	27	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.60e-07	304	390	103	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	1.23e-04	275	298	237	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam13620	CarboxypepD_reg	0.004	16	100	12	81	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV21206.1	2.82e-146	3	400	13	417
QRV22093.1	5.12e-146	17	400	25	414
QIX92999.1	2.93e-145	17	400	25	414
ANU48790.1	8.35e-145	17	400	25	414
QQR02302.1	8.35e-145	17	400	25	414

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001160_01471.