CAZyme Information: MGYG000001162_00708

Basic Information

• Species: UBA1822 sp900545365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822; UBA1822 sp900545365
• CAZyme ID: MGYG000001162_00708
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		54651.99	9.6974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001162	1612933	MAG	Austria	Europe

• Gene Location: Start: 31790; End: 33232 Strand: -

Full Sequence      

MQTVRRHPYAVLILLSAFLFLLGNSLVPVTDTAEANYALTSKEMVLSGDWLSPQIYGRYW
YDKPIFYYWMLSASFSVFGFNEFAARFPSAVFGTLSVLFTFWFARKVYDEKTAWGAALIL
STSLEFFLLAKAVITDAALFLFMSAAGALFYLGYTEDRRWYWGCWAAAALAFLTKGPIGI
ALPGLSCFLFLLLKKDLKEMLHVHLFSGFLLFLLLGGSWYYYMYLRHGSDFLVNFFGVHN
YLRAVVPEHERQNVWYFYIMMFFAGFAPWSFGLLWSLRKKFRRFRESFREMSEPSLFLLL
WAAVVILVFQGIATKYTTYTFPSLFAFAILSARLWRRFFRSVCRAAAVSAAVLTAVILVA
APSVSGRFSGKDAGMALAALDTGSAPILAYDDFRTSAVFYSGKPIFRVVKKDEISQLTPH
GISWNAKNVMPFYAAEDILPGRPYIVCVTEKRKHQFLESVPGRWTELCSAGNTVIFEQKI

Enzyme Prediction     

No EC number prediction in MGYG000001162_00708.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	378	2.6e-102	0.6685185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.44e-49	6	407	7	408	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	5.59e-26	34	333	33	331	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.37e-17	62	185	1	125	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	4.61e-11	12	182	5	189	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	4.47e-04	57	175	56	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25530.1	2.64e-173	4	463	5	464
AXB81444.1	1.74e-167	1	450	1	450
AVO27725.1	2.43e-120	2	478	21	508
AXL22207.1	5.74e-118	23	479	47	521
AEB99017.1	3.88e-117	6	470	6	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.77e-28	34	331	59	360	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.71e-32	34	332	30	318	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A0KGY4	1.07e-25	18	332	14	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	2.80e-24	28	332	24	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
Q6D2F3	9.50e-24	11	332	12	332	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
Q2NRV9	4.03e-23	17	333	15	330	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.670636	0.325766	0.001277	0.000749	0.000623	0.000961

TMHMM  Annotations     

start	end
7	29
65	84
86	103
113	130
137	154
169	191
203	225
254	276
296	313
318	335
342	364