CAZyme Information: MGYG000001162_00987

Basic Information

• Species: UBA1822 sp900545365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822; UBA1822 sp900545365
• CAZyme ID: MGYG000001162_00987
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000001162_31|CGC1	40914.99	7.5901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001162	1612933	MAG	Austria	Europe

• Gene Location: Start: 48633; End: 49730 Strand: -

Full Sequence      

MIRDKIDLKNKKIVVIYMLYFGDMVSLTPFLEVLRREAEGSEISLVVDSRFVDSVRYNPN
VDHIIPADRAHMGMKATWNLGKKIGRQRPDILLVLHGTSRTSLTALAMKPKFWTGEAGTR
LDRFFMDRILLVERKDCHAAEKYLRVLRDMGVEHSENHGMQTFVSGEWEKAAAGFFSEYG
IHDRSDHLLGLSASSSMEAKNWPAACFGRAADHFAEKGYRPVFFGVKSELPLIEKALSVM
KHRDQAVIAAGRLSMGEFMAAASWCDAGLTNDSGPMYVFDSRGVPTIALFGPSNVKLHHP
LGRRSCGLSSSDLPMEQDHVAHTVRDGSYTPIDRIPVEEVIRALEWALGLRESEEYGSHC
KFIKA

Enzyme Prediction     

No EC number prediction in MGYG000001162_00987.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	78	309	8.1e-35	0.8933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.01e-43	12	345	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.18e-41	11	345	2	327	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.11e-21	78	310	2	229	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	1.21e-06	199	301	194	298	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25206.1	5.35e-142	5	353	7	356
ALG42175.1	3.97e-80	6	349	2	343
AVO27634.1	3.97e-80	6	349	2	343
CCC73399.1	3.97e-80	6	349	2	343
AVO74798.1	3.97e-80	6	349	2	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	6.83e-60	7	348	5	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	31