CAZyme Information: MGYG000001164_02238

Basic Information

• Species: Prevotella lascolaii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella lascolaii
• CAZyme ID: MGYG000001164_02238
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773	MGYG000001164_147|CGC1	85696.4	5.1285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001164	3302780	MAG	Austria	Europe

• Gene Location: Start: 6568; End: 8889 Strand: -

Full Sequence      

MISLRNMTLTATIGIACASQAVSPAIRQDKEIERKIENTLGRMTLEEKIGQMTELSIDVL
GEWKDGEFRLDRDKLHNAIAKFKVGSVLNAPGPIAQTPEKWQEIIGLIQEMSMKEIGIPC
IYGLDQNHGTTYTLGGTLFPQNINIGASFNPQLAYDAARVTAYETRAANCPWTYSPTVDM
ARDPRWPRVWENYGEDCLVNAIMGSAAVRGFQGDDPNHIPSDRIATSVKHYMGYSQARTG
KDRTPAYIPVSELREKCFAPFKACVEAGALTIMVNSGSVNGVPMHADKELLTGWLKEGLG
WDGMLVTDWADINNLYTREHVAADKKEAIEIAINAGIDMAMEPYDLDFCTLLKELVEEHR
VPMSRIDDAVRRVLRLKYRLGLFDTPVTHMKDFPEFASEAHKALAVKAAGESEVLLKNRN
GILPLKKGTRLLVTGPNANSMRCLNGGWSYSWQGHIADRYAADHNTIYEALRDEFGKDNV
TLEQGVTYVPEGNYYEENPPEIEKAVEAAAGADVIIACIGENSYCETPGNLSDLRLSANQ
RDLVKALARTGKPVVLILNEGRPRIISDIEPLAEAVVNILLPGNYGADALAGILSGKTNP
SAKMPYTYPKDPAALTTYDYRVSEEMDKMDGAYDYDAVISVQWPFGYGLSYTTFGYDNFR
TSADTFTAGDDITLSVDVTNTGTMTGKETVMLFSRDMVASLTPENRRLRAFRKIELKPGE
KRTVSFNLKGSDLAFVGADGKWILEKGKFRMQAGDKILYLECTETHKWDTQNK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	341	5e-64	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.46e-149	7	754	11	751	beta-glucosidase BglX.
COG1472	BglX	1.46e-82	43	450	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.48e-66	44	376	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.80e-60	89	755	44	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.21e-49	414	651	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ80689.1	0.0	5	773	5	773
QUT31664.1	0.0	5	758	4	759
QNL39941.1	0.0	4	758	3	759
QGT72556.1	0.0	4	758	3	759
QDM10585.1	0.0	4	758	3	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	20	773	1	759	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5TF0_A	1.18e-109	19	754	1	737	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	2.28e-107	25	754	3	738	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	2.31e-107	33	754	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXN_A	1.22e-106	25	754	3	738	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	1	773	1	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	5.63e-153	36	760	80	818	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	6.92e-114	7	754	1	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.82e-112	7	754	1	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	4.57e-93	9	754	10	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.438967	0.255008	0.302686	0.001105	0.000729	0.001495

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001164_02238.