CAZyme Information: MGYG000001164_02368

Basic Information

• Species: Prevotella lascolaii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella lascolaii
• CAZyme ID: MGYG000001164_02368
• CAZy Family: CBM66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
978		109673.22	4.5183

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001164	3302780	MAG	Austria	Europe

• Gene Location: Start: 3146; End: 6082 Strand: -

Full Sequence      

MKNIIVALLAFTATLKLPAQTVITVDASRIEGSVPELIYGAGAEDVNHEIYGGLYDQRIF
GESFEEPAFSSVSGFASYDTPWFVEDGVLRLDTDGFGKIVWQERSLNDASVEVDMRVDGA
SAIAGFIINVSGAADGADAFNGYEVSVNAAERRLVVGKHENNWQPVAEVPLTVSPEEWNR
LRVDFDGGRLSVFLNGDRIYDYEDTSNPLEGGYVGLRSYGGSASFRNLQVDGSKIEFRAM
ADDVENFRRYDDCWTVENNVMKTYTSAFAKAVYQSRDMQEGSVEADVRMDGERSISGFII
DVSDADDGADAFRGYEISLDADDHTLVIGKHDHDWQPIENVQLSFDSSDWNRLRVDFSGN
TFSVWLNGKNVYEYVDEHSPLMKGKVGLRTFDGPASFRNISLNGETVALRSVPTGVSGMW
MPVGDGVYTHDGTQAFNGTYSQKVSGSEDDGICNFGLNKWGIGITAGERMSGYVYLKGDA
ETAYVALQSADGRVEYCRNEISGLGTEWKQFDFGMTPDATDNNARFVVALGGVGSMWVDM
AVLHTESYPYRADLTQDFINERLTFLRYGGTMINAPEYRVKNMMGPRDKRPPYKGHWYRY
STNGFGIIELVDFARKIGTEPAFSINIEDNPQDVLALLEELKPYGVKYIEIGNEENIGDE
SFAAYEHYVERFLAFYNAIRPIYPELQFINAAWWRQDKPELMEYVFRALDGKAALWDYHP
WTDEADQARAVETELKTMRSMFLGWNPQTTMKCAILEENGNTHNMHRALSHAIVLNAVRR
MDGFVQLDSPANALQPYLQNDNGWNQGQIFFNSHMSWCQPPYYAQQMAASHHQPLLIRSA
CRNRNINMTATRSEDGRTVVMHIVNTSSADIPVEIDMRNAGKTVNIRRLSLYGDLTDTNT
PHEPEKIVPRESKPDGMRMTLEARSYTVLEVSCDVLDDIRAITSDDGGDSVYYNVSGQRV
SSPQRGIYIKEDGRKVIM

Enzyme Prediction     

No EC number prediction in MGYG000001164_02368.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	539	933	6.7e-42	0.6587301587301587
CBM66	72	227	5.2e-26	0.9741935483870968
CBM66	254	400	4.7e-23	0.9161290322580645

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00813	Alpha-L-AF_C	2.74e-19	745	925	3	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
COG3534	AbfA	5.48e-17	565	934	65	501	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
pfam06439	DUF1080	5.56e-16	78	230	21	181	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.
pfam06964	Alpha-L-AF_C	4.50e-11	812	925	63	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam06439	DUF1080	1.77e-10	250	402	21	181	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL02085.1	3.71e-194	23	934	30	810
BBL12837.1	2.30e-192	23	934	30	810
BBL10044.1	2.30e-192	23	934	30	810
QKH85487.1	2.48e-191	219	929	51	795
AUI48779.1	4.48e-191	219	929	70	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	6.10e-09	451	928	95	619	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8VZR2	3.81e-20	451	912	141	628	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
U6A629	1.41e-16	441	687	97	386	Alpha-L-arabinofuranosidase A OS=Penicillium canescens OX=5083 GN=abfA PE=1 SV=1
Q0CTV2	9.69e-13	420	827	78	522	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
B8NKA3	7.17e-10	398	882	64	580	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
P82593	1.46e-09	420	827	94	535	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000421	0.998736	0.000300	0.000173	0.000180	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001164_02368.