CAZyme Information: MGYG000001165_00191

Basic Information

• Species: Collinsella sp900758845
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900758845
• CAZyme ID: MGYG000001165_00191
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729	MGYG000001165_7|CGC1	79968.34	5.2649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001165	1950666	MAG	Austria	Europe

• Gene Location: Start: 4421; End: 6610 Strand: -

Full Sequence      

MSESIYTLRVSRAAAGAYPTISDALAAADQLYPDAEQPVMIRVEPGEYRERVEIRRPHVT
IEGETADSVRIMGGLGAKMPSEDGSGVDGTLGTFRTYTVLVDADDVWLENLTIVNDAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPPHEVKPGGFMGPKQYAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPKGEPYGFVFHGCSFT
APDGVAPDSVYLGRPWREWAQTALVDCWLGRHIKREGWWDWNKPAAHSCAQYAGAILHGP
AGDTTDWVPWANKLDVMAAAGYAREQVLAGADGWDPEGGDGDAVETAGLSANGRTVHIET
YCEDEPALRARLKREGRSAAFTGKTPADFEAWKIATRTRLYDVLGLSLMDRVPIEIRELS
RVRVAGGIVRTHAILQVEHDVWMPFYLLEPSCPKLDERGLKRCYICPHGHQGAGAASVAG
VAGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVVGLNVWDNMRLIDYLEARGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVGDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPHPLLVQSCEEDHLN
GARGLKNVDEQLKIVRDAYKLLGRRDGLRHEVCPGEHHLGVAHLAEDIEWLDSHVAECAP
VHSPSACCE

Enzyme Prediction     

No EC number prediction in MGYG000001165_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	6e-78	0.9826388888888888
CE19	464	698	5.3e-26	0.5753012048192772

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.46e-61	6	314	81	388	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.78e-48	16	311	10	275	Pectinesterase.
PLN02773	PLN02773	1.16e-41	8	314	7	282	pectinesterase
PLN02432	PLN02432	1.14e-40	1	334	7	291	putative pectinesterase
PLN02708	PLN02708	1.97e-39	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	729	1	729
ATP54718.1	0.0	1	719	1	719
QUC03567.1	0.0	8	712	7	706
QRP39805.1	7.91e-101	8	336	18	349
ASN95501.1	7.91e-101	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.95e-27	10	310	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.84e-24	33	256	55	269	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	1.38e-22	16	306	17	270	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.52e-22	16	306	17	270	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	6.50e-22	16	330	17	304	Pectinmethylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	2.00e-33	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	2.19e-30	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O81320	6.69e-30	10	328	167	453	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1
Q8L7Q7	1.68e-28	18	324	301	593	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q43062	6.88e-28	10	330	211	505	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001165_00191.