CAZyme Information: MGYG000001169_01999

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter
• CAZyme ID: MGYG000001169_01999
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		39367.08	6.1625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001169	2128230	MAG	Austria	Europe

• Gene Location: Start: 2; End: 1063 Strand: +

Full Sequence      

MTLGVSSHRIEHWFFMGEGRKFDSDVPENAGRDDLYWPAMPIPENTDSITGEPGPSEEFL
NDWLVRTCELIDNYHPRILYFDWWIQHVNAKPYLKKLAAYYYNRAAEWGIEVALNCKYDA
FLFGTAVLDIERGQMADIKPYFWQTDAAVALNSWSYTEGNQFRPAGDIIQDLVDIVSKNG
CLLLNVGPKSDGTISQEDTQILMEIGDWLAVNGEAIYDTHVWKTFGEGPTQVLRVVYDLV
IILLGYAFGAPFAAVTLAMAFLLGPAVSLVGKWLDCWIFLRPASPDSKKAPLKRRPPAAG
ASFPKKGPAAKCGRSLLHGWQTPVHSPLDPSGAKKRLPTGEAAFRLPKPGKFT

Enzyme Prediction     

No EC number prediction in MGYG000001169_01999.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	1	218	5e-48	0.5346820809248555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	6.22e-54	1	232	142	353	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	2.41e-40	1	230	115	333	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	3.37e-39	1	214	145	333	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANW97614.1	8.86e-116	1	232	159	389
AGI38208.1	8.86e-116	1	232	159	389
ANX00174.1	8.86e-116	1	232	159	389
AGC67128.1	8.86e-116	1	232	159	389
QNF28599.1	7.56e-115	1	232	162	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LJJ_A	1.27e-51	1	228	184	411	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	6.58e-51	1	228	184	411	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
4NI3_A	8.94e-34	55	232	199	389	ChainA, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
1HL8_A	1.73e-18	66	223	208	362	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
1ODU_A	1.73e-18	66	223	208	362	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9BTY2	1.10e-16	69	230	215	381	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q5RFI5	1.58e-15	69	230	213	379	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
Q99KR8	1.23e-14	69	230	209	375	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q6AYS4	1.27e-13	69	230	207	373	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
P10901	4.24e-12	47	223	186	367	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
240	262