CAZyme Information: MGYG000001170_00497

Basic Information

• Species: UMGS1603 sp900759005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1603; UMGS1603 sp900759005
• CAZyme ID: MGYG000001170_00497
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000001170_54|CGC1	94993.3	4.5721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001170	2224944	MAG	Austria	Europe

• Gene Location: Start: 830; End: 3283 Strand: +

Full Sequence      

MNRKLTLNGAWEMRAAEDSNWIPATVPGSVYADLLDAGKMEDPFWRDNEQEAFDLMEKDY
VYRRTFELTEENLVCDALNLTCEGLDTLATVRVNGEIVLEADNMHRTWRANVLDFVAPGE
NEIEITFHSPNRAAREAYAENPVNGSTDAVEGFVHIRKAHCMFGWDWGPRLPDAGIWRDI
YLEQIHSARLASVYIRQEHADGKVRLEFEPLIESYDGLCECMQPDYSVRYTVTSPDGETL
TATDADILIGNPLLWWPNGYGKQPLYTVCAELIDDDGERIDLWEKRIGLRTMTVRRNRDQ
WGESFETNVNGVSIFAMGGDYIPEDNILRRVTPERTRRLLEDAKRANYNSIRVWGGGYYP
DDWFYDICDELGIVVWQDFMFACAMYDLSDHFDENIRAEFRDNIRRLRHHASLGLWCGNN
EMEQGVQENWYNASPKLIADYIKMYEYIIPQELRENDPETFYWPASPSSGGSFDAPNDPS
RGDVHYWEVWHKNKPFTEYRKYFFRYVSEFGFQSFPQLKTIQAFTEPEDRNIFSYVMEKH
QRNDAANGKIMNYLAQTFLYPTDFDTLIYASQLLQADAIRYGVEHWRRNRGRCMGAIYWQ
LNDCWPVASWSSIDYFGRWKALHYAAKRFFAPVLLSCEEQGTLTQRTNVNSEMREDAVEK
SIRLNVSNETLHPVEAEVRWALRNARSEILQFGTETVEVPALSAKWLEKVEFPEAKLRDD
YASYELWCDGVRVFSGTVLFCPPKHFAFADPHLTVEREGNELIVSADAYARAVEITCEDG
DVLFEDNYFDLNAETRRIRILRGEGTKFTVRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000001170_00497.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	703	4.6e-110	0.6848404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.48e-102	6	671	14	681	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	4.65e-13	662	745	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	3.58e-12	750	815	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	2.68e-10	188	290	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	5.28e-10	174	458	195	468	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99964.1	0.0	1	816	1	808
QIB55233.1	0.0	1	816	1	808
QMW76907.1	0.0	1	816	1	808
QTE69834.1	0.0	3	817	2	811
QTE73768.1	0.0	3	817	2	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	4.50e-167	5	791	6	822	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	4.63e-167	5	791	6	822	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	3.32e-166	5	791	4	820	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	3.42e-166	5	791	6	822	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.03e-160	5	815	9	836	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	3.58e-127	3	640	5	663	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	6.69e-127	6	640	8	661	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1D911	9.86e-127	3	640	5	663	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	7.48e-126	3	640	5	663	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q5B7W2	1.40e-125	7	640	9	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001170_00497.