CAZyme Information: MGYG000001170_00642

Basic Information

• Species: UMGS1603 sp900759005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1603; UMGS1603 sp900759005
• CAZyme ID: MGYG000001170_00642
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		95011.53	5.8585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001170	2224944	MAG	Austria	Europe

• Gene Location: Start: 2596; End: 5124 Strand: -

Full Sequence      

MLQINRIGANFHILKGGMRTRLVDARGKVYFSWGAISDRENARQTACRVRAGEWDSGWIQ
REQMWIQYGGAPLPEGVPIEITVEIRDNFGETAIPGTEIFYNARADWRAGWIAANEDVRG
RAVYFRREFSAKKPVERAILYACGIGYHALFLNGRRIGGAKLDPAHTDYTRECQYIMEEI
ALEQGENCLSAIVGEGWRRNDQTLHTLSDGREVRFNGIPQLTVMLKIAYSDGSIEWLYTD
SDWQAGAGAIANNDLFNGETFDARRAVPDWNKVGFTGFSAAKAVEKPGGRMEPMIVEPIV
ECEAREPVAIWNVGGAWMIDFGENIAGVVRLRLPEELVAGQTIRIRHSEELEEDGKSLFS
APLRGAKAEDIYIASGDARDLRVWQPEFTYHGFRYARIDGVPALSPKDVQAVSLRTDMDK
RAFFRCGSALVTRIHDLAIATERANQHGILTDCPQRDERQGWMNDATVRFQETPYNFDFT
RMFEKIVGDLIGAQSPDGAITCTAPYIFGCRPADPVCSSFLMAAFESYRHGGNLRLLKNA
YPHLCAWEKYLLSRSEGFIVNYSYYGDWAAPVYACITNESGEGAQSATTPGIFMSTGYSY
LNCRILEQCAEILGENPAFWHDMAEKIRRAMLEKWYHSETARIATGSQGCQAFALWLKII
PEQDAPRAAKLLRDDLVSRDYRFTTGNLTTLYMLEMLTEYGYVNEAWNLITREDYPSYGF
MIQQEATTVWERFELKKNPEMNSHSHPMFGSIDKWLQASICGVYPTGAGWTEFTVRPHFP
EKLMSAQTAFETPLGEVAVRWFKRYGETHLHVTVPFGARAKVAFGGETHEIGSGFHDFAI
KL

Enzyme Prediction     

No EC number prediction in MGYG000001170_00642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	315	823	2.1e-130	0.9841269841269841
CBM67	111	288	1e-24	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.92e-77	419	760	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.86e-39	133	299	1	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.82e-27	315	412	6	99	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.68e-13	762	822	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	2.75e-165	31	822	55	849
AEF82974.1	9.86e-156	26	822	41	839
VEH16339.1	1.41e-149	106	822	146	851
QEC51112.1	4.18e-146	28	822	89	893
AHF90970.1	3.42e-144	37	822	40	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.13e-123	23	822	46	896	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.90e-97	88	842	272	1032	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.71e-83	2	841	2	866	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	3.00e-95	88	840	272	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	6.10e-81	122	822	184	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	6.93e-75	54	830	91	884	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	5.94e-71	31	821	53	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001170_00642.