CAZyme Information: MGYG000001170_01213

Basic Information

• Species: UMGS1603 sp900759005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1603; UMGS1603 sp900759005
• CAZyme ID: MGYG000001170_01213
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BglY

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		36365.88	6.6853

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001170	2224944	MAG	Austria	Europe

• Gene Location: Start: 21148; End: 22092 Strand: +

Full Sequence      

MPDLKLSFFGHGGDYNPDQWRDYPGILEEDIRLMKLSRCNLMSVGIFSWAALEPEEGNFD
FDWLENVLNRLHENGIFVFLATPSGARPAWMSAKYPEVLRVRPDGGRNLHGERHNHCLTS
PVYRRFVKRINSALAERFSHHPAVVGWHVSNEYGGDCHCELCQNAFREYLKKTYGTLDKL
NAAWWTGFWSKTYTDWNQLHSPAPIGEMSIHGLNLSWKRFQTAQTVDFMRAEIEPLRAAN
PSLPITTNFHSDFHDLDYRRFAGNLDFASYDNYPAWGRDDAREAMLSAFKYDFTRSILNK
PFALMESTPSQVNW

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	14	314	2.7e-124	0.8113207547169812

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	1.11e-144	14	314	1	305	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	6.38e-107	5	314	12	320	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam01373	Glyco_hydro_14	5.60e-04	137	193	161	217	Glycosyl hydrolase family 14. This family are beta amylases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX31553.1	1.03e-146	3	314	9	322
QTN00749.1	2.25e-146	5	314	9	321
CEP78374.1	6.54e-146	5	314	11	323
QAW36131.1	8.99e-146	5	314	11	324
AKQ71556.1	8.99e-146	5	314	11	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E9A_A	5.74e-142	5	314	35	347	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
4OIF_A	2.29e-132	5	314	11	330	3Dstructure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_B 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_C 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus]
4OJY_A	2.36e-132	5	314	12	331	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]
5DFA_A	1.83e-131	5	314	11	330	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]
3TTS_A	4.29e-86	1	314	1	315	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C8WV58	7.70e-145	5	314	10	321	Beta-galactosidase BglY OS=Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) OX=521098 GN=bglY PE=1 SV=1
O07012	4.84e-128	11	314	3	316	Beta-galactosidase GanA OS=Bacillus subtilis (strain 168) OX=224308 GN=ganA PE=1 SV=2
Q65CX4	7.03e-128	11	314	3	316	Beta-galactosidase GalA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=lacA PE=1 SV=2
Q0TUR6	2.43e-120	5	314	10	326	Beta-galactosidase Pbg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbg PE=3 SV=1
Q09HN2	2.44e-93	1	314	1	316	Beta-galactosidase BgaP OS=Planococcus sp. (strain L4) OX=377621 GN=bgaP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001170_01213.