CAZyme Information: MGYG000001171_00834

Basic Information

• Species: UMGS1590 sp900759105
• Lineage: Bacteria; Firmicutes_B; Peptococcia; Peptococcales; Peptococcaceae; UMGS1590; UMGS1590 sp900759105
• CAZyme ID: MGYG000001171_00834
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	MGYG000001171_61|CGC1	26151.99	5.9859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001171	2228600	MAG	Austria	Europe

• Gene Location: Start: 23164; End: 23874 Strand: -

Full Sequence      

MKRLISMLIRLVIVLVLFVLVTVTTVCGVIGYVGYKNATADRPVTQAIGEVQAQANYTPI
DNIPVIYENAVIATEDHRFYDHGGFDVVATIRALLHNAFAHEVLEGGSTITQQLAKNLYF
DNTPSFTRKLAELFIAKDIEKHYPKDQILAAYINCIYYGNGYYNIYDASMGYFGVPPAQL
NNDQATLLAGVPNAPSLYAPTVNMTLARQRQQQVLNAMVDNNMLTREEANSIAPLT

Enzyme Prediction     

No EC number prediction in MGYG000001171_00834.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	219	1e-58	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.54e-61	57	219	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.12e-61	57	229	4	176	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.14e-56	57	230	78	252	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.89e-49	57	230	69	242	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	7.31e-41	32	225	22	230	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM09777.1	7.74e-64	36	232	44	240
QUO38940.1	3.23e-63	36	232	35	231
QRV21928.1	1.58e-62	36	233	3	200
ADL05597.1	2.31e-62	36	233	15	212
QJU22158.1	5.74e-62	36	229	34	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.13e-37	57	228	22	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	4.24e-37	57	228	22	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	9.45e-34	50	216	52	233	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.03e-33	50	216	16	197	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.06e-33	50	216	17	198	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	1.90e-37	39	228	54	241	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q07259	9.61e-37	38	228	30	219	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O86088	1.07e-35	39	228	54	241	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1
P0A0Z5	1.99e-35	39	228	54	241	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P0A0Z6	1.99e-35	39	228	54	241	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.501457	0.095999	0.391517	0.000792	0.000470	0.009766

TMHMM  Annotations     

start	end
13	35