CAZyme Information: MGYG000001172_01458

Basic Information

• Species: Fusobacterium sp000235465
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium sp000235465
• CAZyme ID: MGYG000001172_01458
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		29992.51	8.1989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001172	2065216	MAG	Austria	Europe

• Gene Location: Start: 13542; End: 14273 Strand: +

Full Sequence      

MIEKKIHYVWFGNAKPEKVLKCIESWKKNLPDYEIIEWNETNFDVEEELKNNKFFRECYK
RQLWAFVADYVRVKILYNYGGIYLDTDMEIIKDISSLLNSDLFLGYENEDTMSFGIVGVI
PKHRVFKKMYEFYQNEIWKSPLHIVTNILTDILEEEYQGRYKENNIDIYPREYFYPFNHD
EEFTEACIKKDTYAIHWWGKSWKKNPKVYFLKYKHLPWWKKHPKHIAKLINYYFKNLFNF
RKE

Enzyme Prediction     

No EC number prediction in MGYG000001172_01458.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	18	100	2.5e-26	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.69e-66	1	243	81	320	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.52e-17	16	104	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	8.13e-08	1	135	45	190	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.002	44	88	151	194	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.004	4	74	1	81	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALQ36331.1	6.20e-189	1	243	1	243
QYR55306.1	6.20e-189	1	243	1	243
ALQ37078.1	5.95e-187	1	243	1	243
QNE67910.1	8.13e-185	1	243	1	243
ATV56546.1	5.07e-179	1	243	1	243

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQW4	6.82e-09	1	208	1	217	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
Q5ZU30	2.94e-07	2	88	28	137	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1
P38287	5.99e-06	1	129	61	189	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q10323	7.78e-06	2	123	57	178	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001172_01458.