CAZyme Information: MGYG000001177_00176

Basic Information

• Species: Massilicoli timonensis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Massilicoli; Massilicoli timonensis
• CAZyme ID: MGYG000001177_00176
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	MGYG000001177_4|CGC1	54364.65	5.1144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001177	1850660	MAG	Austria	Europe

• Gene Location: Start: 63132; End: 64538 Strand: +

Full Sequence      

MELKEPFLWGSATAAYQCEGGYREDDKGESIWDVFCHSEKNNINAVTGDVASDHYHRYEE
DIRMLKEGGQNAYRFSLAWTRIIPKGTGKISQAGIAFYKRVLAACKKYGVTPLVTIYHYD
LPQPLMEIGGWENREVAEAFADYAQVCFEAFGDEVRHWVTINEPDYDTMCAYAVGNYPPN
VTDMNRRAKALYHMLLASAKAVSRFRKLQAKGMIGLVHAPYPIATLQDDLAYREAAKNAD
LFYNRCIADPTITGWFCDDLFVKLKESNIDLSFIKEGDKQCFMEGTVDFLGLNVYERAVV
KPYTSGETCLKINNTGKSKDKTSIIVKGWFELDKDSEVKRNPWGMEVYPKCIYDLLYMMK
ERYGDIPFIITENGIGYYDKLENGQVHDPYRIEYLDGFIDWMWKAKEEGIDVRGYFVWST
MDLYSWINGYEKRYGLVYVDYEDHEKRYPKDSYYWYQKKIDEKEGKEL

Enzyme Prediction     

No EC number prediction in MGYG000001177_00176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	463	9.8e-151	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	3.09e-172	1	467	2	457	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
TIGR03356	BGL	1.14e-166	7	456	4	426	beta-galactosidase.
pfam00232	Glyco_hydro_1	4.94e-165	5	457	7	445	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.16e-139	3	466	5	469	6-phospho-beta-galactosidase; Provisional
PLN02849	PLN02849	1.88e-89	5	456	32	476	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70230.1	6.21e-220	3	466	1	464
AEE90266.1	1.46e-208	1	468	1	469
CDI40268.1	1.46e-208	1	468	1	469
AIS09340.1	2.94e-185	7	460	4	460
QJA01910.1	1.04e-181	3	467	1	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	1.06e-128	1	460	9	445	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
5YHS_A	3.40e-120	1	468	1	469	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)],5YHS_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)]
5YIF_A	2.72e-119	1	468	1	469	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)],5YIF_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)]
4PTV_A	1.22e-114	5	461	9	445	Halothermothrixorenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTV_B Halothermothrix orenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTW_A Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTW_B Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTX_A Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168],4PTX_B Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168]
3TA9_A	1.47e-114	5	461	15	451	beta-GlucosidaseA from the halothermophile H. orenii [Halothermothrix orenii H 168],3TA9_B beta-Glucosidase A from the halothermophile H. orenii [Halothermothrix orenii H 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97EZ2	2.12e-109	5	458	6	459	6-phospho-beta-galactosidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lacG PE=3 SV=1
P26208	5.38e-109	7	460	10	443	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P10482	1.33e-108	1	462	3	453	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P42403	8.26e-107	7	457	13	467	Aryl-phospho-beta-D-glucosidase BglC OS=Bacillus subtilis (strain 168) OX=224308 GN=bglC PE=1 SV=1
Q08638	4.56e-104	2	456	5	435	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001177_00176.