CAZyme Information: MGYG000001177_01581

Basic Information

• Species: Massilicoli timonensis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Massilicoli; Massilicoli timonensis
• CAZyme ID: MGYG000001177_01581
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	MGYG000001177_33|CGC1	93515.53	4.3133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001177	1850660	MAG	Austria	Europe

• Gene Location: Start: 145513; End: 147990 Strand: -

Full Sequence      

MRDYLQGKRCMVWSFMGNTRMYQALRDYGDRLDTVGIFTFEVDATGTISETGTSISTMLT
YINKWPHIKWMLTVMNHGTASIFTALRNNTDGAKDKFLTELVRIMEKYPWCAGVDIDLER
GGEYENRAAANALFRDIYNTVKAYDSTKLINLCLPGMTSVNGSVGGENWCVYADLDAYCD
TAAIMSYGMAWAGSAPGPVSPRDWLEGIYDYASSVMDPKKIFLGLPGYGWNWQIYDTPEN
LGKTYRGTSNTYYAAKLWMTGGYNFTNDTAPQPLIPILAYWDDYDKVPWALPQVYDFMEG
QDAVYKEYPLMGEVYNRRRYLTAYAKQQNTEFGDILIDRGGGDVDSYSGIVSVSDYMITL
GDEGSASYAFTIDEAGTYDVAVRICFPFWDKNSVTVSVDGVSQTFSENRLWWPYWRTTCW
FPLVTGHSFSAGTHTLTVDVGVNGVQFYGFRVCTDFSEEPTAGVAQFTLSPRQFIDVDGN
PCKPDKGFKLTCEMLRRKPDSALIWYEDFRDDTILPESYWTTLSGEWDVWQESLPYGDTS
RPYSQLEGEGQLAWLYSGFDDVHIRARLAFPADGGGRAGVFCGSLFCCLNYDTQQVELYN
GSTLLGSYATSFSKTSDADLRTNPNMYTIEMRIRGNKIRVYSSNSYTLRFTATVSGFSGG
YAGFRSDGHAVCELLRLGDAWTYEPYERFDVTFPDGSVVEYGRIDRSNAVWDEEFQVFTL
TSDVEEISTRSEDISLDYEFYHSDLLALECGNDYTVTVTPKDINVWVSRLFLGDADGFSI
LYYQDVDSLVYWANEAAYRWKLRGIAIWSLGQEDMRLWEALPKQI

Enzyme Prediction     

No EC number prediction in MGYG000001177_01581.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	45	291	2.9e-27	0.652027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	3.38e-27	18	255	12	238	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.45e-18	23	250	119	342	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd02795	CBM6-CBM35-CBM36_like	5.31e-10	331	452	3	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.
smart00636	Glyco_18	2.49e-07	37	290	30	294	Glyco_18 domain.
cd06549	GH18_trifunctional	5.14e-06	23	232	15	214	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU66284.1	0.0	1	825	1	823
QQY45022.1	0.0	1	825	1	823
AXB62530.1	0.0	2	825	3	823
AXB69977.1	0.0	2	825	3	823
AUV57934.1	0.0	2	825	3	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WIW_A	7.17e-07	71	283	76	294	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001177_01581.