CAZyme Information: MGYG000001180_01483

Basic Information

• Species: Muribaculum sp001701195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp001701195
• CAZyme ID: MGYG000001180_01483
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	MGYG000001180_28|CGC1	66032.48	4.6743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001180	2921277	MAG	Austria	Europe

• Gene Location: Start: 44878; End: 46698 Strand: -

Full Sequence      

MKKSLLATGMCLLIAGGMTAQETAPAFPGAEGFGRYTQGGRGGKVIHVTNLNDSGEGSLR
WALSQSGAKTIVFDVGGYIDLKSQLNVSSNTTIAGQTAPGDGITLRYYTLYFGNCDNVVV
RFIRSRRSQVKDVNDGADATWGRRRHDIIIDHCSFSWSIDEVASFYDNRDFTMQWCSLGE
GLANPGHSKGSHSYGGIWGGKGASFHHNYLTHIQNRAPRFNGARYNWSGYDKTRFENSIQ
AEQVDFRNCVVYNWGNGNGCYGGPGGGYINMVNNYFQAGPGTKNKTRVTQVSVSDSSNGG
DNPFPGYASRYYIDGNYVSAASEPENYDWSGVIYDGGLSLIDGERYIIDENHYYGSDVEY
KKNNKDQDCVRLRLDSPIAAGEVTTHNATTAYEKVLAYAGASLVRDAVDTRYMEEARTGT
TTYNGDVAYVDANGKKYATSGTKGILDFINDPNGTEEPKTASFPALAQVKRTDNFDTDGD
GMPDAWEKANGLDPNDPEDGALYTIDTERGWYTNLEVYLNSLVADIMLAGQSDGIEGVDE
YYPQSTDADLSDTVVAGIGNVTVENGIAAIEYYSLDGIRLNEPAEGISIRRIIHKDGSVT
ADKVIK

Enzyme Prediction     

No EC number prediction in MGYG000001180_01483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	76	276	4.7e-69	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	3.06e-09	5	219	9	235	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	6.85e-05	74	230	1	169	Amb_all domain.
pfam18884	TSP3_bac	7.12e-05	476	497	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD40778.1	5.10e-288	10	606	5	598
QCP73827.1	5.10e-288	10	606	5	598
QNT67774.1	4.57e-200	25	606	5	586
VEH16322.1	6.18e-194	2	585	4	553
AGB28243.1	1.40e-193	5	543	9	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	4.77e-09	31	230	46	254	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	6.73e-53	26	523	22	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
A1DPF0	3.52e-51	26	523	23	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q2UB83	4.77e-51	26	523	22	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q4WL88	4.80e-50	26	523	23	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	6.66e-50	26	523	23	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000391	0.998443	0.000614	0.000210	0.000173	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001180_01483.