CAZyme Information: MGYG000001182_00799

Basic Information

• Species: CAG-269 sp000435535
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp000435535
• CAZyme ID: MGYG000001182_00799
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		44801.18	4.9862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001182	1766269	MAG	Austria	Europe

• Gene Location: Start: 39429; End: 40643 Strand: +

Full Sequence      

MKKSVKIIVICLIIVAIFIAIDIINNKVEQNNINNNIIDETTNNINENYISNVVNKNNKV
TDNSSIIECKEKVKQIMSKMTLEEKVGQMFLARYPSSGVTNEIEDGKPGGYILFGRDFDN
KTKSKIISELENNQKASKIKMILGVDEEGGTVVRVSSHKAFRSSKFLSPQEIYNKGGIDA
VLQDSEEKSGLLKSLGINMNLAPVADITSNTNAFIYKRTLGQDVQTTANYIAEIVKNMKQ
SNIISVLKHFPGYGDNVDTHTGIAIDERTMEEFEQTDFIPFQSGIQNGTPCILVNHNIVK
CMDSTMPASLSKNVHEILRNKLNFTGVVITDDLAMDAVKKYAENNETAVQAVLAGNDMII
SSDFLAQKQEVLDEINAGKIDIELIDNAVERILSMKYAYGIISD

Enzyme Prediction     

No EC number prediction in MGYG000001182_00799.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	133	360	3.2e-44	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.80e-58	80	401	1	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.25e-57	81	395	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.36e-28	109	359	27	277	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.71e-14	73	404	38	361	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61427.1	7.51e-116	73	402	153	482
QNM02560.1	2.37e-114	71	404	87	420
ASW43722.1	2.25e-113	70	402	56	388
QHQ63470.1	9.23e-112	72	402	84	414
BCT44094.1	4.05e-111	73	403	125	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.37e-38	80	396	11	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.18e-36	75	400	37	397	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.69e-36	75	400	11	371	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	5.77e-36	75	400	41	401	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	2.16e-34	82	396	9	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	6.45e-36	75	400	37	397	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q0AF74	6.73e-27	100	360	18	281	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
P48823	1.97e-26	109	396	65	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
D4AQ52	3.59e-26	82	378	21	326	Uncharacterized secreted glycosyl hydrolase ARB_06359 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_06359 PE=1 SV=1
Q82SJ8	3.07e-25	109	376	29	297	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.641674	0.352880	0.002241	0.000922	0.000412	0.001870

TMHMM  Annotations     

start	end
7	24