CAZyme Information: MGYG000001182_01610

Basic Information

• Species: CAG-269 sp000435535
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp000435535
• CAZyme ID: MGYG000001182_01610
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
861		93951.17	8.4929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001182	1766269	MAG	Austria	Europe

• Gene Location: Start: 21488; End: 24073 Strand: +

Full Sequence      

MPNNNSNKRAKKRNSNRDNVQNENTTNRKKTNPNEVNKKGKKKVINPKVKIALKILIIII
LLACVVGAGIIAAMFFGVFGDDFEITKDELVVGSSNTIVLDKSGKEIANLSTDEKRKVIS
LSEMPDYLPKAYIAIEDKRFYKHNGVDLKRTTGAIVGVVTGKDNGGGSTITQQLVKNITD
DKQRSGIAGVLRKVKEWSKAVQVERMISKNQILELYLNIIFVGGNELHGVELGSIYYFNK
SAKDLDLAECAFLAGINNSPNAYNPYDTSKDHSELIKKRTLTVLSEMKNQGLIENEEEYN
AAVAKVEAGLTFSKGNTGGEAQYSYHTSATINQVITQIMEEKGISYDLAYNYVYGSGLTI
YSTEDSTIQAAVEDEFSKTKYQVAGRAKNPDGTLQNEHTQAGMVIIDHTTGQVVAVGGEL
GSQYATGWNRGTQLKRQTGSSMKPIADIAPGLQEKVITAATIYDDKTTEFSVGASKYKPG
NSNNSQLGYINIRTCIKVSHNIPMVKIMTELTPKKSLEYLNKMGLTNLNEKDDGILALAI
GGMKTGISPLEMAGAYATIANDGVYITPTFYTKVVDTNGNTVLTSKQEKTRVISEQNAYI
TRSILQEPLTTGGTATYCKITGMETCAKTGSTDDYVDRWLCGMTPYYTAACWFGYDNNQE
PMYVKGKGLVSVDGKNPAGALWSAIMKNIHKDLKNKNFTKPDGIVEKTVCKTTGCLATDT
CTAKYTDIFTSDNLPEKCEGHGTQVICQVSNKVANEYCPTDSVKTVAYGGIIPKEKLGLW
KTLNPSSTSNDKIEDICDVHKKPVEQPKKPEQNTTTNSTTGNTTSNATTDDKNNSNKNNT
GDKGNSTAVKNNTADQNVTSH

Enzyme Prediction     

No EC number prediction in MGYG000001182_01610.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	104	288	4.3e-56	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.22e-150	115	692	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.51e-147	67	702	27	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.28e-102	64	717	16	746	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	2.13e-76	105	690	134	683	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	5.25e-75	99	729	39	600	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV70266.1	3.13e-133	38	817	12	789
AEM77825.1	4.43e-127	35	768	11	734
ADH60128.1	9.58e-127	39	768	18	734
ADD01592.1	7.25e-126	39	768	18	734
ADU75447.1	2.70e-124	84	776	63	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	1.41e-68	88	739	14	811	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	6.30e-57	202	664	2	441	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3DWK_A	8.72e-52	99	660	10	562	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3ZG7_B	1.67e-51	202	664	2	441	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2OLU_A	9.60e-49	99	660	19	571	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	1.32e-107	39	765	3	726	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.32e-107	39	765	3	726	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	2.39e-107	39	765	3	726	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q891X1	9.49e-95	36	721	4	690	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
A0PZT1	1.14e-92	84	760	58	754	Penicillin-binding protein 1A OS=Clostridium novyi (strain NT) OX=386415 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999522	0.000464	0.000002	0.000001	0.000000	0.000013

TMHMM  Annotations     

start	end
51	73