CAZyme Information: MGYG000001186_00111

Basic Information

• Species: Agathobacter sp900547695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900547695
• CAZyme ID: MGYG000001186_00111
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000001186_1|CGC1	92943.37	5.1573

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001186	3291648	MAG	Austria	Europe

• Gene Location: Start: 124476; End: 126944 Strand: +

Full Sequence      

MQCQNFNEDWTFEKANQADRLKAFYGNSNAVAVTLPHDAMIREKRDKDCPSGAQSGFYPG
GVYTYEKKFMAQNEWKTQDVFLEFEGIYGIARVWINGALAAVNRNGYMGFSVDLKPWISY
ENENIIRIDVDNSKQPNSRWYSGSGIYRDVNLWTGKDVYISHDKLRITTLSVNDDMAVIE
VCAQLKNIIGHGLEAECLIEIKKDGQKTASDTQRVVFRSEQMQTVRVQIPIEHPKKWSPK
QPALYECHITTKFDDKICDEAVSNFGIRVLELDPVHGLQINGETVKLRGTCIHHDNGVIG
AETFKEAEWYRCKRLKEAGFNAIRSAHHPMSIAMLDACDHIGMLVMDELTDMWDKEKNTY
DFSDIFEDQYNQWINHMVEKDYNHPSVIIYSVGNEIQEAGTKQGAWINRMLCNKFHELDN
TRYTTNALNGLNCAGRRLGFIMRDVAEKFGMDSHGSGSGGGSNALNSFMSLMSGEKGEFF
AKHPLVSEALEECSQSCDITGLNYLSGRYELEHELHPAKTVLGTETYPADIENLWKLVET
YPHVIGDFTWTGYDYIGEAGVGIFHYDGNANFTSIYPERLGYIGDIDLIGNRRPISYFRE
IVYGLTDKPYIAVERLEHAGQTAGKTAWMFKDNISSWTWKGFEGTTANVDVYSSGEEVEL
FLNDKSLGRKPAGRENHFTASYEVPYEPGALKAVAYQKDRKLGEYELSTAKSVTKLKVCR
VTENERKIAYIKIWLVDDNGTINSQEYEKRLLHASVVGNGVLEGFGTANPSSEDDYFSDS
VTTFDGSALAAVRWKDVKSKEPAVLKVWTDDGCQVMINIENN

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	567	7.1e-95	0.5904255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.18e-51	1	423	10	428	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.10e-27	58	405	63	425	beta-D-glucuronidase; Provisional
PRK10340	ebgA	4.83e-25	65	422	113	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam16355	DUF4982	3.46e-22	644	704	1	61	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
PRK09525	lacZ	3.39e-20	65	395	124	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK94949.1	0.0	1	822	1	822
ACR75761.1	0.0	1	822	1	822
CBK90733.1	0.0	1	822	1	822
ANU47447.1	4.09e-309	4	814	4	814
QQR03657.1	4.09e-309	4	814	4	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	3.04e-125	4	793	8	751	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	6.47e-125	4	793	8	751	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	5.22e-86	5	793	29	793	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
3GM8_A	8.47e-82	5	800	8	779	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
7CWD_A	2.89e-81	5	793	5	775	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	8.78e-83	5	793	46	822	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	2.68e-70	5	717	50	715	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.50e-36	4	820	54	824	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	2.25e-32	5	392	7	384	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	9.67e-29	5	394	30	437	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001186_00111.