CAZyme Information: MGYG000001186_00880

Basic Information

• Species: Agathobacter sp900547695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900547695
• CAZyme ID: MGYG000001186_00880
• CAZy Family: GT2
• CAZyme Description: UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000001186_2|CGC7	31568.8	9.1731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001186	3291648	MAG	Austria	Europe

• Gene Location: Start: 348107; End: 348925 Strand: -

Full Sequence      

MGFSVLMSIYYKEKPDNFAQCMDSLLAQTSLPDEIVLVEDGRLTDELYKVIDEYAGRMGN
INFVRLRLDENRGLGIALSYGIKHCRNRLVARMDTDDIAVKDRFAMQLKAFSKNPSLDIV
GGYIDEFIDEPDKPYSVRMVPISQKDIYKYQRRRDAFNHMTVMYKKNTVIEAGNYKDCLL
MEDSLLWAEMIKNHAHMANIPKVLVHARCGDDMIDRRGGMDYFFKYRNGRKRILKTGTIS
YADYCVTVAAQFVVCIMPTALRRFIFKKILRK

Enzyme Prediction     

No EC number prediction in MGYG000001186_00880.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	10	158	4.8e-24	0.8470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	2.05e-89	4	208	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	4.38e-20	4	162	1	152	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.73e-19	5	122	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06423	CESA_like	1.79e-13	11	183	6	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	4.52e-10	11	206	63	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK92921.1	2.83e-129	3	271	6	274
CBK91510.1	5.42e-127	3	271	6	274
ACR76347.1	4.02e-125	3	271	9	277
QQY26854.1	4.09e-97	3	272	5	273
SQG46398.1	3.39e-87	3	272	6	274

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48215	1.28e-56	1	272	1	267	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q03084	1.01e-51	3	272	8	273	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase OS=Escherichia coli OX=562 GN=wbbD PE=1 SV=1
Q46635	1.74e-50	3	222	2	216	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
Q4KXC9	6.03e-12	4	246	10	245	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1
D4GYH3	7.84e-09	1	124	1	120	Glucosyl-dolichyl phosphate glucuronosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
239	261