CAZyme Information: MGYG000001186_01235

Basic Information

• Species: Agathobacter sp900547695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900547695
• CAZyme ID: MGYG000001186_01235
• CAZy Family: GH36
• CAZyme Description: Bifunctional alpha-galactosidase/sucrose kinase AgaSK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
946	MGYG000001186_4|CGC1	106458.76	4.7368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001186	3291648	MAG	Austria	Europe

• Gene Location: Start: 103428; End: 106268 Strand: -

Full Sequence      

MAIIFNPNKKIFTLQTAHTTYQMQVDRLGYLLHLYYGAKSTCDMDYVLTYADRGFSGNPY
AAGMNRTYSLDTLPQEYPTLGTGDFRNIALDIKNEQGTESVELLYKSHEIRDGKYALKGL
PAVWASDDEAQTLEIVLGDDIAGVEVHLLYGVLEACDVITRSVLIKNTGSGNITIEKAHA
ACLDMVYGDYDVLRFYGKHAMERNLERTHLGHGTLSFGSRRGTSSHQYNPAVILAQRDTT
ENAGDCYGMLFVYSGNFSCEAEKDQINQTRLLMGLSDELFSYPLAAGETFTVPEVIMSYS
ADGFSQLSHQYHTCISEHVCRSRFAHEVRPVLINSWEAAYFDFTGDTIVDLAKEAASLGI
DMVVMDDGWFGKRDDDNSSLGDWFVNEKKLGGTLSELIDRVHAQGVKFGIWIEPEMVNED
SNLYREHPDWAIQIPGKLPVRSRNQLLLDFSRKEVRDNIFDQICTVFDQGKIDYVKWDMN
RSMADVYAGNLAYDYVLGVYDFMERLVTRYPDILLEGCSGGGGRFDAGMLYYSPQIWCSD
NTDAINRTRIQYGTSFFYPVSSMGAHVSAVPNHQTGRVTSLKTRGITAMAGTFGYELNPA
LLSDEEKEEIREQIKTFKKYEMLINEGTYWRLTSPFEDEVAAWMSVSRAKDRALVSVVRL
YAEANAAACYVKLKGLESDAVYIEENTGRQYTGAALMNAGIPLPFAVKEYEAYQFSFIRL
DEAKKLYDEIKKVCGNLKLSEADTADSSSDKRIVISIYGGSGSGKTTIAAALQQYFLNDN
TACYVLTGDNYPHRIPMRNDEERLNVYNESGEEGLRGYLGTPKEIDFDRINKELSEFKAG
KDIIEIKHMGREDGDISYDETDFTGIKVLILEWTHGGSEYLKGVDIPVFLDSSPEETKAR
RIKRGRDENAVSPFICRVVELEQEKLDLQDKNARIVVGKDGKVYEQ

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	11	702	2.9e-267	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	0.0	289	627	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	0.0	12	701	4	665	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	1.23e-141	329	619	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	2.55e-110	29	285	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	6.04e-24	640	717	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR74280.1	0.0	1	946	7	952
CBK94329.1	0.0	1	946	1	946
CBK89379.1	0.0	1	946	1	946
AWY97922.1	0.0	1	946	1	935
CCA61959.1	0.0	1	946	1	935

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	0.0	1	720	1	720	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	2.62e-221	1	705	1	712	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	5.23e-221	1	710	1	717	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	4.71e-219	1	710	1	717	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNP_A	4.71e-219	1	710	1	717	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	0.0	1	946	1	935	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q9ALJ4	2.86e-220	1	710	1	717	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	1.61e-217	3	717	6	728	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	3.40e-205	10	722	11	732	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
P27756	1.81e-172	52	719	50	719	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001186_01235.