CAZyme Information: MGYG000001186_02431

Basic Information

• Species: Agathobacter sp900547695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900547695
• CAZyme ID: MGYG000001186_02431
• CAZy Family: CBM86
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1230	MGYG000001186_17|CGC2	134230.62	4.6951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001186	3291648	MAG	Austria	Europe

• Gene Location: Start: 24895; End: 28587 Strand: +

Full Sequence      

MKRKKLLKQGVCIAVCSTMLATGGTPLIPAYQAQSLVFADEVQQNIKTYTADQLEVDWGN
AGYERTDGVWKVTFKNQYDQVKWRLPESVDMSTVKSVTFNVKDQKGSVSLKVYKSGQEDA
DPANTQYELTGKEEYSISPTGEGDMEAVGLMTTDKAGSESAISLVSVTVETDTTPKAPPE
IEKDIEDWKDSVTSDDALGKDAIAGTGIMLSEITDDTLMKLVEKHFNAVTFGNELKPDAL
FNYQLENSVKTKTVQFDGQDLLVPVVNDAGDSLDFSRADAMVDKILEWNEANPDRKIRIR
GHVLVWHSQTQEWFFHENYDISQPYVDKDTMNRRLEWYISSVFDHYFGEAANGKYDGLFY
GWDVVNEAVIGNTYRTDTVSTAESLDEIRHGNNSSWWHVYQSNEFIINAFKYANKYAPKN
VELYYNDFGETDNIKSEGIIKLISDVKSAEGTRLDAFGMQAHYSVDSFSAAQFKKVAQKY
AAAAGKVQLTELDFQASAAYKSGAASKDSEYTKMAYCHKQLFDAAKDLKKNGTNVAGITV
WGVIEPNSWLHSQSNLGGGADGSKQCPLLFDGKYKAKPAYWAYVDATKLEPSIQDIVVAE
QKGDTISGTEYSFSDDDTQAAFIPTWDKDGLNVLVSVKDATIDDTDAVTVYVDETNSAGD
VTPVKRTVKRSEAQAVDGGYRATIKVPMTDLKVAKTIGMDVKVMNKDKAVNFNDLTGKQE
TSSKYYAKATLKPGIERVTKGTVKIDGEADSAWDKAVAIPFTINLKASVTADAKVLWDDE
NLYVYATVKDPVLNKDGGDAYQQDSLEVFIDENNAKTESYDDDDKQYRINYENEHSFNGK
KCLEENVQSSAKVTGDGYVIEAAFRWTDIQPKEGDRIGLEFQINDADASGTRIGTLSWND
ETGMGWSKSSVYGTIELTAEAKDEVSDDNSKPGTDKPSTGNAEEPGTNKPSTGNAEKPGT
NKPSTGNAEKSDTNNSSTGNPEKPGTNKPSTGNPEKPGTNKPSTGNPEKPGTNKPSTGNI
EKPGTDKPDINKPSADKPATGSTKSDVKQTAEGATISHNISETDKANAGITVTNNKPDIA
DASLESVKADLKVNDVKDISVIDVFDVKAPANYDGNPIWITLDANYSADYSVLHFQDGKW
VVLETRKSSDGKLQAKFTKFSPTAIVSTAPKASPKPADTTAADKTAKTKTDAKKAANTSD
QSATAAFIVLFLAGVSMAGASRLRRSRKQS

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	201	586	3.2e-78	0.9636963696369637
CBM9	745	917	1.9e-51	0.9945054945054945
CBM86	58	167	8.1e-32	0.9813084112149533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00005	CBM9_like_1	5.85e-78	738	918	4	185	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
smart00633	Glyco_10	2.77e-68	271	582	11	262	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	1.34e-65	205	585	13	310	Glycosyl hydrolase family 10.
pfam06452	CBM9_1	8.82e-54	745	918	1	182	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd20907	CBM86	1.74e-46	47	172	3	127	carbohydrate binding module family 86. This family describes what is most likely a xylan-binding module such as found in the Xyn10A protein of Roseburia intestinalis L1-82, which is involved in the extracellular capture and breakdown of xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV24088.1	0.0	4	931	2	1114
CBL13458.1	0.0	19	931	1	1098
EEV01588.1	0.0	19	931	1	1098
QJU17095.1	3.35e-210	180	918	413	1147
ADL32778.1	1.37e-209	74	923	257	1066

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1I82_A	1.71e-43	741	917	8	187	Family9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Cellobiose [Thermotoga maritima],1I8A_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Glucose [Thermotoga maritima],1I8U_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a [Thermotoga maritima]
2W5F_A	1.28e-41	205	580	195	521	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6D5C_A	3.64e-41	201	586	30	350	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
3W24_A	1.00e-39	205	594	20	334	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from Thermoanaerobacterium saccharolyticum JW/SL-YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
5OFJ_A	1.46e-39	205	587	22	339	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36917	1.90e-88	205	920	369	1045	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
P38535	5.77e-87	205	920	221	897	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
Q60042	5.10e-85	221	917	393	1053	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
Q60037	6.01e-82	219	917	395	1057	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
O69230	3.51e-79	181	917	364	1083	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003690	0.962420	0.031888	0.001293	0.000367	0.000294

TMHMM  Annotations     

start	end
1203	1220