CAZyme Information: MGYG000001187_00067

Basic Information

• Species: UMGS1472 sp900552095
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1472; UMGS1472 sp900552095
• CAZyme ID: MGYG000001187_00067
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959	MGYG000001187_1|CGC1	110365.11	5.0447

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001187	2296696	MAG	Austria	Europe

• Gene Location: Start: 77337; End: 80216 Strand: +

Full Sequence      

MSIKFSVLVPVYNVEKKWLELAVESVKRQTYQNWELCLVDDCSTDPEVRKNLEQLRSDKI
RVKFLEKNGGISAATNEAAKMAEGEYLVLMDNDDELNCQALEKFAAAIEQTGAEILYSDQ
DIVDTEGGHREPLCKPDWSQDLLLSQMYIGHLLGFKKTLFEKAGGFRSEYNGSQDYDLML
RMSELTDHIVHVPEILYSWRAIPSSTAVNPESKPYAQVVGLKAIQDHLDRVYGSGEAKAE
ETENYFVYDVRYRLEEQPLVSVIIPTKDHADLLKGAIDSIFEKTEYSNYEILILDNNSEE
KETFAYFEQVVKEHENVRVEKAAFPFNWSRLNNFGMEKAKGDIFLFLNNDVKVIAPEWMT
RLAEKAVRKGIGVVGGLLLYEDGTIQHAGVVAGMGGWGDHVFKGMQPVHYGSPFVSPMVT
RNVTAVTGACMAISRETIEKIGVFDENFIICGSDVEICVRAIQKGYRNVYDPYVKLYHFE
SKSRDSYIPPVDFEMSDKMYQVYREKGDPYFNRQLDSYSCVPRMAEKESRDVVQVEKKEG
ILEKLKRKYRQMSRNTEPVTQEKEQPVDTHIAEINPYTFRKVEYPRKRINLLLPSINPEH
VFGGISTALKFFEKLADELGYDRRIILVDAVPGEETRAKYRDHYTFAEWNEDCQEQNQIV
PYAYRSQCTLPVSEKDYFMFTGWWTAHCTQEAYEDFQEKTGIAPNPFINFIQDYEPGFYA
WSTRFLLADATYKNEYPQIAVFNTRLLQEYFHNNGYQFAWEFAFDPVLNGQLKSCLDQLG
TSIQKKKQILVYGRPGTERNAFKLIVAALRRWVEQQQDIEEWTILSAGEQHAKVDLGRGK
YLQSVGKLTLQEYAKTLEESYAGISLMASPHPSYPPLEMSVFGVKVITNTFANKDLKDFN
SNIVSLNNISPSHIAKELKKICDNYRMIVPHEMTNQEYCDNENVFDFIKEIKQILNKDA

Enzyme Prediction     

No EC number prediction in MGYG000001187_00067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	131	7.9e-29	0.7411764705882353
GT2	261	441	1.2e-20	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.25e-93	4	201	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	3.22e-36	262	480	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	1.02e-29	6	200	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.01e-29	6	160	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	4.49e-26	258	513	3	256	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU15227.1	0.0	2	955	7	949
ANU74717.1	0.0	2	955	7	949
QQQ92265.1	0.0	2	955	7	949
ASU27522.1	0.0	2	955	7	949
QBE99399.1	0.0	2	955	7	949

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X0E_A	3.32e-109	567	955	27	413	Complexstructure of WsaF with dTDP [Geobacillus stearothermophilus],2X0E_B Complex structure of WsaF with dTDP [Geobacillus stearothermophilus],2X0F_A Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus],2X0F_B Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus]
2X0D_A	2.64e-107	567	955	27	413	APOstructure of WsaF [Geobacillus stearothermophilus],2X0D_B APO structure of WsaF [Geobacillus stearothermophilus]
5TZE_C	8.32e-12	4	116	2	116	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	1.71e-11	4	116	2	116	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
5HEA_A	2.54e-11	6	115	8	116	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	1.06e-115	6	889	322	1187	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	2.33e-111	6	484	369	851	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
P77414	8.54e-15	6	182	8	188	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
Q4UM29	1.42e-14	6	350	17	381	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q92IF9	5.70e-14	6	350	17	381	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001187_00067.