CAZyme Information: MGYG000001187_01373

Basic Information

• Species: UMGS1472 sp900552095
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1472; UMGS1472 sp900552095
• CAZyme ID: MGYG000001187_01373
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	MGYG000001187_35|CGC1	61444.47	4.0922

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001187	2296696	MAG	Austria	Europe

• Gene Location: Start: 7395; End: 9038 Strand: -

Full Sequence      

MKKGKLLGVLMAMAVGLQVSSPVTFAETNSETDPFIRGVDVSTLDMLEKLGAHYYENGKK
GDALGILHNNGANYVRLKIWVDPYDKDGNPYGGGNNDFETTLSLAKRAKEQGMGILIDFH
LSDFWADPANQIKPKAWEGLSFSELETTVYQYMKDTLNDFAKEGIVPEMVQVGNEISSGI
LHDEGKVENSEEQFQNLGRLLKKAIAGVRDSEAKGTKIILHLDQGGKNDLYTWWFGNLLK
QFPDLDFDVIGVSYYPMWHGTMEGLQYNLNYLSSTYDKEVCVVETAYAWTTEDADEDGNV
FIEGDQNIAGYSATPEGQIEFMNDLESIILNVPEGRGLGYFYWEPEWVPVEGGTYATQAG
VDYKNDTVTPTNTWDNMTLFDFSGNALDSMKVLNKPMPNLLDNASFESDKITTEPSQWNI
WLSDVTQKGTIKTEYGNAFDGDYKLTFWDDSDYDCSVYKTFEGIPNGKYQFSVWAMTNGE
QKVLQMYAKNFGGTELNTPITTSDINWNLFTIDEIEVTNNTCEIGIYTEANAGDWCNLDF
AMLRKID

Enzyme Prediction     

No EC number prediction in MGYG000001187_01373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	36	392	1.8e-128	0.9941520467836257
CBM61	399	539	9.4e-39	0.9574468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	2.20e-141	1	394	2	392	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	1.07e-135	36	393	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97255.1	2.70e-215	169	547	1	378
BBF43144.1	2.13e-213	10	547	9	548
ASA20573.1	8.17e-180	35	545	33	543
ATF71403.1	7.90e-172	1	545	1	542
AYJ44852.1	7.90e-172	1	545	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.29e-92	35	392	50	390	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	5.12e-78	35	392	24	387	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	3.95e-77	35	392	24	387	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	5.10e-60	37	395	5	331	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	2.88e-58	37	395	5	331	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.51e-88	33	399	4	352	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	5.70e-77	35	392	49	412	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	2.26e-73	35	392	53	416	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P83692	2.79e-59	37	395	5	331	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
P83691	1.57e-57	37	395	5	331	Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens OX=34413 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.998977	0.000185	0.000189	0.000181	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001187_01373.