CAZyme Information: MGYG000001192_01652

Basic Information

• Species: UBA1777 sp900549865
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA1777; UBA1777 sp900549865
• CAZyme ID: MGYG000001192_01652
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		54142.25	8.7001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001192	2283296	MAG	Austria	Europe

• Gene Location: Start: 610; End: 2013 Strand: -

Full Sequence      

MYDGIKLFLEWVGYFFIAYLIGYSTFLFLSVVVGSLELYKHRRQEMLKSILPSDYYLPIS
IIVPAYNEEVTVADTVRSLLTLEYRAYEIIVVDDGSKDRTSEVLAETFDMHLVHRPIRRQ
INCQREEYVYETRAQKVPVTLIRKKNGGKADALNMGINAANFPYFICMDADSVLQYDSLR
RIAQPILENGNVVAVGGIVRISNDVELENGRVKHYRLPRNILAFMQVLEYDRSFLASRIL
FDRFNGSLIISGAFGLFKKDTVIAAGGYDSGTVGEDMELVVKLHEYCTVNNIDYAIRYAS
DAICWTQAPERLRDLCKQRKRWHLGLFQSMYKHRVMFSNHRFGAVSFVSYLYFLIYELLS
PFIEIFGVFTMVLAWWFDLINVPFMLLFFLIYAVFGSVLTLTAFFSRIYTADLTLSFGDG
LKAVCLCLFELVFLRFILAWVRCTAFIGYRKKKLSWGRIERRKIDLK

Enzyme Prediction     

No EC number prediction in MGYG000001192_01652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	60	222	6e-28	0.7764705882352941
GT2	164	389	3.1e-20	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.24e-62	61	276	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.25e-48	11	462	10	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	3.28e-45	12	404	6	354	N-glycosyltransferase; Provisional
pfam00535	Glycos_transf_2	2.57e-27	60	260	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK14583	hmsR	4.92e-24	59	374	77	371	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL04658.1	5.77e-199	8	465	15	472
QUO31269.1	9.15e-189	1	463	1	463
QNK56534.1	9.48e-189	1	466	1	466
BAN78238.1	1.09e-188	5	464	10	469
BCK79145.1	6.77e-187	192	467	1	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	5.85e-08	59	204	7	127	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
6P61_A	2.75e-06	59	323	15	224	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5MLZ_A	3.32e-06	57	223	23	157	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKQ0	6.81e-31	19	325	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	1.76e-30	19	325	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q7A351	2.98e-29	16	325	3	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q9RQP9	2.98e-29	16	325	3	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q6GDD8	2.98e-29	16	325	3	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000090	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
337	356
360	377
384	406
426	448