CAZyme Information: MGYG000001195_00623

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1994
• CAZyme ID: MGYG000001195_00623
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270	MGYG000001195_4|CGC1	32228.73	7.7729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001195	1782257	MAG	Austria	Europe

• Gene Location: Start: 38750; End: 39562 Strand: +

Full Sequence      

MSIPKKIHYCWFGRGEKPELVKKCMESWKKFCPDYEIIEWNEDNIDISANQYAKEAYEKK
KYAFVADYARLYVLYNEGGIYMDTDVEVLKPLDKFLEEKAFSGFENNNKLTTGIIAAEKH
NEWIGDLFHIYDDLKFLDAKGEMDLTTNVERVTKVTHEKYGLEEKSCYQNLKDGTVVFYP
SEYFSPKDWFTGNINVKENSYTIHHFSASWHSEKEKNNERMYKKKLNRYIEKYKDVEVAK
QKLNQMETYKFYLTHPVKAVKRIFEKMRGK

Enzyme Prediction     

No EC number prediction in MGYG000001195_00623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	98	2.1e-28	0.9777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.23e-22	3	123	82	206	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.39e-21	18	101	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.31e-15	3	131	46	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.001	48	85	156	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM62840.1	1.68e-86	3	216	2	214
AIQ37491.1	3.59e-82	3	210	2	208
CCV64690.1	8.68e-81	3	218	9	223
QDM45306.1	1.83e-80	2	210	6	213
QHR93120.1	2.15e-79	3	216	2	214

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	1.34e-06	2	107	56	170	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001195_00623.