CAZyme Information: MGYG000001197_00035

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus
• CAZyme ID: MGYG000001197_00035
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000001197_1|CGC2	40569.33	8.3616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001197	1377267	MAG	Austria	Europe

• Gene Location: Start: 44002; End: 45072 Strand: -

Full Sequence      

MKGRKVRYYLKDSFLHNQHEKNAGSKARNDVEAILISEGYKGLEIKVDNWYQMNFFKAQQ
HKYSATKSVFDQLGSGDELVIQFPIIHHTFFIAQLIKQAQKRGAKFYLLIHDIETLRHAA
GSEVKLRHKLRNYFQEKKALMSVDGIIVHNDIMKSVLANQGFPADKMVSLEIFDYLIPNF
QEKSLPQKEQAIIVAGNLNPTKSGYLYSLPESPAYNLYGVGYDESRALNNITYFGAFMPD
DLPVALEGSFGLVWDGDSSETCQGTYGNYLRFNNSHKASLYLAAGFPLVVWKQSALSNFV
LQNQCGLAVESLHDLSQVIEHLSEEDYQFLLENAKRIGKKLREGFYLTKALRQLNM

Enzyme Prediction     

No EC number prediction in MGYG000001197_00035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	17	354	2.3e-105	0.9813664596273292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	4.48e-97	17	356	10	331	sugar transferase.
cd03794	GT4_WbuB-like	1.91e-10	85	353	102	388	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMP67395.1	3.86e-236	6	354	1	349
SQG04994.1	2.94e-222	6	355	1	350
ARC46701.1	1.20e-221	6	355	1	350
BBA07939.1	1.82e-218	6	354	1	349
QLL98140.1	7.42e-218	6	354	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	1.89e-16	27	351	22	322	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	1.71e-47	8	354	2	323	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
Q9AEU1	5.88e-21	27	351	20	325	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	1.64e-18	15	351	8	325	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
A0A0H2UR93	1.07e-17	76	351	65	326	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
F8KEJ1	1.31e-16	15	351	13	330	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001197_00035.