CAZyme Information: MGYG000001201_01230

Basic Information

• Species: CAG-451 sp900758495
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-451; CAG-451 sp900758495
• CAZyme ID: MGYG000001201_01230
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
961		105498.16	8.7791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001201	1330564	MAG	Austria	Europe

• Gene Location: Start: 11282; End: 14167 Strand: -

Full Sequence      

MKKKTKQKQNSNLMLIFLGAFLILMIISYFIIGWLLTAFLGVGILVIVGFAHLLDKVKNK
PKQKKILNIIIIIILSLGILVMLLGIAFLAYVVIKAPKFDVSQLNEKEPSILYDINGNEF
ERLGTEMREKVTYDELPEVLVDAIVATEDSRFFQHNGFDAPRFLKASLGQLVGHSDAGGA
STLSMQVIKNSFTSADDHGIKGIIRKFTDIYLSVFKLEKNYTKEQIIEFYVNNHNLGGNI
YGVKQAALAYFNKDIGDLNLAEASIIAGMFKAPNLYKPTNTDNIKSVTRRRNTVLYLMER
HGYITSEERQMATSIPVESLVDYNVSAQNGLSKYQGYIDTVVDECIEKYKADPYTVSMKV
YTNLDRSKQDGVDKVMNGESYTWANDTIQSGVSVLDSATGKILAIGAGRNKKGAKELNLA
TSDEIKRQPGSTAKPLFDYGPLIEYNNASTYGYNNNGNYKLFIDEPYSYTNGKSINNWDG
TFMGAISMRKALSLSRNIPALKAFQQVDNKKIIEFVQNLGIEPEIENGKIHEAHALGAFT
GVNSLQMAAAYAAFSNGGYYNEPYSVSKVIFRDTGEEKKHEGVRRQAMSDSTAYMITSIL
DDVTLIGSGNLDKVAMKTGTTNFDEKTRKTLGMSDDAIRDSWTIGYTTKTVIGMWYGYTS
APKELVNQGLYCHNLKCSTQKDKLFAALAKEVFEKNKEEFKMPSSVVKLGIVAGSNPAKI
AGAGYSGAITYEYFKKGSEPTSTQTTEENLAAPTNLKAVYNSNNNTVSLSWNAVTPPSST
SSYGTFGYNVYFNNTLLGFTSNTSFTVTNQSNPYGTYKVIAAYKSYDGIRSNAATYELKK
TSSTLRVTYTPISTTSYNVSDITRYVTVTENGNNVTSKTSNWKLTSITGPGGASLSATTL
STPGAYTLRYEFTYDGEKKETGNITVTINANNSGNGNGSGSGSGSGTDSGGENNKDNETI
E

Enzyme Prediction     

No EC number prediction in MGYG000001201_01230.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	117	298	1.1e-51	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	1.78e-134	81	662	27	575	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.16e-87	84	766	20	790	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.03e-60	116	299	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	6.39e-60	83	657	7	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	8.20e-39	82	569	15	595	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APH04640.1	5.00e-149	70	772	35	714
AWI12666.1	4.51e-147	58	772	17	714
ACJ33515.1	1.82e-145	55	783	14	727
AXM90108.1	9.92e-145	55	783	14	727
AST07024.1	1.39e-144	55	783	14	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	5.37e-80	104	706	2	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	3.63e-78	95	706	2	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.64e-53	216	664	2	438	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.11e-49	216	664	2	438	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2ZC5_B	2.02e-47	332	719	3	390	ChainB, Penicillin-binding protein 1A [unidentified],2ZC5_D Chain D, Penicillin-binding protein 1A [unidentified],2ZC6_B Chain B, Penicillin-binding protein 1A [unidentified],2ZC6_D Chain D, Penicillin-binding protein 1A [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	3.63e-126	85	772	52	728	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q04707	2.51e-90	59	719	2	653	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q00573	6.79e-90	59	671	2	613	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q8DR59	1.78e-89	59	719	2	653	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	2.42e-65	60	726	3	630	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	32
36	54
67	89