CAZyme Information: MGYG000001202_00135

Basic Information

• Species: Ruminococcus_D sp900539095
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D sp900539095
• CAZyme ID: MGYG000001202_00135
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	MGYG000001202_1|CGC3	92835.7	9.7261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001202	2406243	MAG	Austria	Europe

• Gene Location: Start: 146383; End: 148908 Strand: +

Full Sequence      

MKFFPKLTGVVLSAAILSQSVPFVCAAEGSDIQIKRPEGYTVTEVTTDNGLVEPVTEDDP
SYLKYLENNMQNGVRTMSALWGAESLTHQSRFNGISKVYGIDVSYYQGNIDWTKVKNSGV
EFVIIRVGYRGYGKSGTLVEDPRFKTYLDGATKAGLKVGVYFYTQAINTEEAVAEANFVL
DRIKGYNLQMPVYYDIESVDYDTGRLDSAGLSKAQKTALCNAFCDTIIKSGYSAGVYANY
TWLNYYIDGAALGQKYPIWLAHYTKNTNYDGRMDMWQYSGSGTVSGIPAYTDVNVWYADE
QPLWVSNLISVSNTTSSNTIAWNPSSDATGYEVWQWSGKGDKYNLIGTTTESVFTNSGKS
SGTMRKYKVRAYSDASGQRVYGSFSNILATCTLPDRISWIGAYASGTSVTLNWSTVSKAT
DYLVEHYENGAWKTINSTTNLSYTVSGITESGTNYFRVMPRRYYGGNYYYGDCTYVNAVV
ADIPNKVTGLYSVSNTSSSNTLSWNAVANATGYEVYQWTGKNDNYAYLGSVKSTSFTNSG
KSSGTMRKYKVRAFNDSTGECITGAYSDVISTCTLPANVSFTVCSTNVNSVTLNWNKVSK
ANSYQVDMYSNGTWKTLGTTSKKTYTVGSLSDGGTYYFRVRAIRNYNGAAYCGNYSAKTI
TISSANAPTSLKSKSNTTSSNTFTWKAASGAAGYTITQWTGKGNNYKKLGNTTSLTYTNS
KKAAGTMYRYRVQAYYVSDNVIQYSKPVQLTVCTLPGSVSIKSAKRSGSTVKFTWGKVSK
ATSYEVYIKSGSKWKKLTTTSKTSYTAKGLNRHKSYKFRIRARRNYKGTIYYGKYTNKTV
K

Enzyme Prediction     

No EC number prediction in MGYG000001202_00135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	101	287	7.4e-50	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	6.51e-79	100	297	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	5.37e-35	99	296	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	1.72e-31	100	294	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	8.17e-30	101	287	1	180	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	4.47e-24	99	297	1	193	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO05379.1	0.0	1	841	1	846
ADU22705.1	5.22e-86	1	708	1	686
CBK82808.1	4.17e-84	6	800	5	842
BAK47549.1	9.25e-58	72	571	174	670
QNM02116.1	1.45e-55	96	297	905	1099

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	5.80e-18	100	318	22	227	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	4.16e-17	100	318	22	227	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WW5_A	4.55e-17	101	297	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.07e-16	101	297	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
1JFX_A	1.40e-13	96	316	3	217	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P34020	6.54e-17	100	294	3	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P26836	7.27e-13	100	318	11	216	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	2.51e-12	96	316	80	294	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P50899	2.89e-11	484	754	704	983	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1
P76421	4.47e-07	98	295	67	253	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000372	0.998868	0.000232	0.000182	0.000161	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001202_00135.