CAZyme Information: MGYG000001205_01585

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger
• CAZyme ID: MGYG000001205_01585
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000001205_71|CGC1	44173.35	7.153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001205	2359919	MAG	Austria	Europe

• Gene Location: Start: 2485; End: 3648 Strand: +

Full Sequence      

MPNEHPKVAIVHDWLVSYAGADRVVDCMHHVFPDAPIYTLVYDEKKMPEWFCSYDVRTTW
VQKLPFATRIYKKLLPLMPRAFEALDLSEYDLVLSSSSSCSKGVITRPDAVHICYCHTPT
RYVWDFYYTYRANANPLVRAVMPGQMYKLRQWDKCAADRVDYFIANSRYIARRIKKYYRR
DSDVIYPCVHINESPFVPKEDFYLVVGRFTWYKRIDLAVAACTKLGRKLVVIGSGDEEAR
LRAIAGPTVQFLGGGLSDEEVRGYYLRAKAFLFPGEEDFGITPVEAQSAGTPVLAYGRGG
ACETVEDGRTGLLFHVQTADSLAACIERFEAGGVSGTPEQIRAHSRRFSEQRFEEELRAY
CARRMKDWAEELRACAHEPNPTQEGSE

Enzyme Prediction     

No EC number prediction in MGYG000001205_01585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	197	329	4.4e-29	0.8875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03804	GT4_WbaZ-like	2.54e-162	7	358	1	356	mannosyltransferase WbaZ and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbaZ in Salmonella enterica has been shown to possess mannosyltransferase activity.
COG0438	RfaB	1.29e-31	53	374	47	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	7.85e-31	199	330	1	142	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03801	GT4_PimA-like	2.03e-30	107	373	82	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	4.30e-26	31	359	36	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ85468.1	1.56e-145	7	360	2	355
QEH66969.1	3.62e-144	7	360	2	355
QES75750.1	3.09e-141	7	360	2	355
CUU50752.1	1.02e-139	7	360	2	355
QGH27715.1	6.05e-135	7	360	2	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F9F_A	2.91e-14	189	324	12	155	CrystalStructure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A. [Archaeoglobus fulgidus DSM 4304]
6N1X_A	2.43e-06	144	321	130	328	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	2.55e-06	144	321	146	344	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6CWQ0	4.30e-08	2	307	5	367	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG2 PE=3 SV=1
Q59002	1.08e-07	200	328	208	345	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
Q880M9	1.73e-07	203	328	302	435	Glycogen synthase OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=glgA PE=3 SV=1
Q4ZS46	1.73e-07	203	343	302	448	Glycogen synthase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=glgA PE=3 SV=2
Q48JG9	4.05e-07	203	328	302	435	Glycogen synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001205_01585.