CAZyme Information: MGYG000001206_00460

Basic Information

• Species: UMGS1491 sp900554775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1491; UMGS1491 sp900554775
• CAZyme ID: MGYG000001206_00460
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		51257.31	10.0387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001206	1026515	MAG	Austria	Europe

• Gene Location: Start: 78109; End: 79479 Strand: +

Full Sequence      

MTFKKLKYLRLKKILTAVALAYLMTSAVNAGFFKSGNYNLPLQKSILISPFKRVNPHIKW
TSSNPRVATVDNHGVVHAKSRGVAEISAYHNSRRDCCTVTVTEPEAIRSVYTNIPKENER
LVVYAMTPKNVQKVKFIITGPNYYKEVCCYNKSDNGENYIWQEDVGTAGSGTYALTAYSN
IGGNWKSSPNCKIDFSISEGSHRSSVTSLSRKNLSRDGMNFIIRQEGFCPKIYVDIANCL
TIGCGRVVYPGETFYDNCNKQEAYQDFLTRINKYRFTLAINNFLVNNKIAFNQHQFDALV
SFSYNLGKGWLSSSSLRNTILSAGSGSNEGTVTAKTGLFLRSGPGTNHRRITSLYYGNKV
AILGKSGNWYHVRTHSGATGYCCADYISAGNGGERSLNSINRHRLISEFSQYHHAGKKCI
KGLLRRRLEELEIFFYGNYRSHAPFRKYPTPPCFNK

Enzyme Prediction     

No EC number prediction in MGYG000001206_00460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	215	320	1e-18	0.7445255474452555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	7.40e-21	218	317	1	95	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam08239	SH3_3	1.00e-14	336	388	1	54	Bacterial SH3 domain.
COG3772	RrrD	1.80e-10	214	341	7	123	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
smart00287	SH3b	2.72e-08	327	381	1	55	Bacterial SH3 domain homologues.
cd16901	lyz_P1	3.21e-08	214	317	2	99	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA51100.1	1.72e-12	214	320	3	104
QJI00463.1	5.96e-12	214	320	3	104
AWB43148.1	2.44e-10	214	322	495	602
QVG63981.1	1.49e-09	212	324	75	184
QQN37305.1	2.43e-09	213	340	2	117

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	5.60e-07	212	316	50	152	ChainA, Lysozyme [Acinetobacter baumannii]
2KRS_A	5.30e-06	329	393	2	65	SolutionNMR structure of SH3 domain from CPF_0587 (fragment 415-479) from Clostridium perfringens. Northeast Structural Genomics Consortium (NESG) Target CpR74A. [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000408	0.998884	0.000198	0.000175	0.000159	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001206_00460.