CAZyme Information: MGYG000001209_00718

Basic Information

• Species: Porphyromonas uenonis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas uenonis_A
• CAZyme ID: MGYG000001209_00718
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000001209_10|CGC1	37486.66	4.9402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001209	2042909	MAG	Austria	Europe

• Gene Location: Start: 43415; End: 44392 Strand: +

Full Sequence      

MNSSQMDEIRRDPTRWRRLLRYITWSLWGAVLVGIVYYFVVVYRAPQAEPDHAHVTPQTE
WRDVPIAEVGAGEEYQILEQYADLYLLEYVLLYDPLCSWADLDDEDDDEDDEEELVQTRQ
RGFSSASYGESQEHYGQSERLPGIVSDWDHLFQRYGSKYGWDWFVLAAIAYQESKFRTEV
VSRGGATGLMGIMPATGRRYGYSRAKLKHAESSIRVACMALQDFGRSFAHITDSEQRMKF
TLASYNSGSAHVLDARRLAENAGLDPDRWDDSVEIFMARLSEPKYYNDPLVQHGRANGDH
TVRYVTEVFSRAQSYKSKVQYATTK

Enzyme Prediction     

No EC number prediction in MGYG000001209_00718.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	161	321	3.7e-21	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	2.48e-69	152	316	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	9.68e-32	140	308	267	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	6.37e-30	139	305	285	440	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	7.21e-15	151	269	9	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.23e-14	152	259	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12384.1	3.86e-161	1	323	1	329
BAK25352.1	6.75e-50	58	318	215	471
AUR47574.1	6.75e-50	58	318	215	471
AKV63991.1	5.06e-49	58	318	215	471
AUR49330.1	5.06e-49	58	318	215	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	2.93e-17	139	308	254	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	3.02e-17	139	308	261	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	3.02e-17	139	308	261	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	4.32e-17	139	308	247	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	4.32e-17	139	308	247	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	3.70e-20	151	318	289	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q0AQY9	3.74e-20	140	308	281	444	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
B1JRW4	7.86e-20	141	308	283	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=mltF PE=3 SV=2
A9R413	7.86e-20	141	308	283	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltF PE=3 SV=1
Q1C5E6	7.86e-20	141	308	283	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43