CAZyme Information: MGYG000001210_01645

Basic Information

• Species: Mediterraneibacter sp900553885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900553885
• CAZyme ID: MGYG000001210_01645
• CAZy Family: GH120
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		73139.2	5.0749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001210	2584596	MAG	Austria	Europe

• Gene Location: Start: 247; End: 2202 Strand: +

Full Sequence      

MEYHVAVTGNDRFCGSSGEPFRTISKAAETARSGDTVTVHEGVYREWVKPAHGGRSDSER
ITYQAAPGEHVVIKGSEEIKDWERFRGNVWRAEVPASLFGAENPFAQSLWGDWLIWPEDG
SVHAGDVYLNGKSMYEAYSLEDLENPSVRTDGYNPPWTKHREPIPHPEDTLYQWFAEVRD
DKTVIYANFQGADPNQELTEISVRRCCFYPERTGINYITVRGFEMAQAASPWAPPTADQP
GMLGAHWSKGWIIEENILHDAKCSAVSIGKEYSTGDNECTRYRRKPGYQYQMEAVFKAVH
KGWDKETIGGHVIRNNRIHDCGQNGIVGHLGCIFSRIYGNEIYNIGVKHEFFGYEIAGIK
LHAAIDAQIEENYIHDCTLGTWLDWEAQGTRVSRNVYAGNDRDLMIEVTHGPHTVDNNIF
ASSYSLDNIAQGGAYINNLICGTMRREPVPDRTTPYHMAHSTVPLGTAFVYGGDDRWYQN
IFLGGQTTYTEQSVAGTGGYNGHPASMEEYRREIAGQGNGDHEAFDHVKQPVYIQRNCYL
NGASAYEKETDAFISKENPEIRIEETEEGVYLNITVPEEMLSHTGEVITTEMLDMPRIVE
ERYEAPDGSAVMFDTDIRGEKRSAAVLPGPAATLKKGKNRILVWKKTESGN

Enzyme Prediction     

EC	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH120	311	400	1.1e-38	0.978021978021978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	1.49e-06	309	418	55	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam07602	DUF1565	6.29e-05	7	46	1	40	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.
pfam13229	Beta_helix	9.90e-05	309	438	9	122	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO17287.1	0.0	2	645	3	646
QBE96849.1	0.0	2	644	4	646
QIB57327.1	0.0	2	644	4	646
QMW79894.1	0.0	2	644	4	646
ASU29529.1	0.0	2	644	4	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	5.23e-272	1	644	1	638	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001210_01645.