CAZyme Information: MGYG000001211_01040

Basic Information

• Species: Porphyromonas sp900548415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900548415
• CAZyme ID: MGYG000001211_01040
• CAZy Family: GH77
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		70541.38	6.3106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001211	2151794	MAG	Austria	Europe

• Gene Location: Start: 13438; End: 15255 Strand: -

Full Sequence      

MSQMPRQAGIAVPLFSLRRHGDAGCGDFATLEAFAPVAERMGVRIIQLLPLEDTTLYGDS
RDSYPYRPLASTALNPIYIAVDQLPPLADQQLEQELRAEAERLSAQKAFDYTEVWQLKRR
WLWASFTEQADASPYFTDMINRYARLTRKHAPSSHSPIWHYWVCERMALDLLPDLNREAW
NFWEEWKRVKKLEEKNKRLVVYTGNFYAYCYMVAQRQMRRAVATIRQHGLSLMGDLPVGV
DPHAADTLAYPDKFNKRLSCGAPPDYFSPDGQNWGVLTCRRNWRMLWQERFGYLERFYDY
LRVDHVLGFFRIWSIPRDGRSGMLGYFLPSRRYLKREIAKLGLAETLRPEWIAPSKKPVT
TQDVLWIERLDAGYVPRYDVASAAPFATLSPDLQERMRAVCEEYYYGGNEELWRERGLER
LTFLKSLTSIHLCAEDLGMVPQCVYPVLEELGILKLYVERMPKSAGIEFEAAPYFSEDSV
GTTSTHDCAPLRLWWAEDEARSRRYYDYFLADYGVPYDTTLTPELAEIIVRRHLESPSRL
CILPLQDWLALSPEHCATVDPHSEQINDPSNPHHVWSYRMPSHVEELPDDWIRQLRQMIA
ETHRL

Enzyme Prediction     

No EC number prediction in MGYG000001211_01040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	12	597	7e-103	0.9838056680161943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02950	PLN02950	5.86e-108	6	590	260	902	4-alpha-glucanotransferase
PLN03236	PLN03236	3.69e-103	6	605	60	742	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	1.15e-102	12	581	1	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	2.21e-70	3	587	9	499	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	8.92e-54	2	605	1	497	4-alpha-glucanotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12916.1	0.0	1	605	1	604
QUB42334.1	3.99e-107	3	605	232	883
AAQ65928.1	1.85e-104	4	604	1	653
ALO29872.1	8.45e-103	4	604	240	892
ATS06078.1	1.18e-102	4	604	240	892

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CPQ_A	3.46e-16	6	595	70	557	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1X1N_A	2.23e-15	175	605	179	524	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	2.54e-15	175	605	231	576	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
5B68_A	7.24e-15	7	317	177	473	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
4S3P_A	2.16e-14	9	316	145	460	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69Q02	1.08e-88	6	590	263	905	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
Q8RXD9	2.22e-82	6	590	269	911	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q9Z8L2	2.91e-38	9	587	26	509	4-alpha-glucanotransferase OS=Chlamydia pneumoniae OX=83558 GN=malQ PE=3 SV=1
Q9PKU9	4.02e-38	9	587	30	513	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1
O84089	3.82e-32	9	587	30	513	4-alpha-glucanotransferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999582	0.000483	0.000003	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001211_01040.