CAZyme Information: MGYG000001213_01064

Basic Information

• Species: Parolsenella sp900544655
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Parolsenella; Parolsenella sp900544655
• CAZyme ID: MGYG000001213_01064
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000001213_106|CGC1	33548.85	5.2327

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001213	1749982	MAG	Austria	Europe

• Gene Location: Start: 4397; End: 5317 Strand: -

Full Sequence      

MMEDSRYAETLERHRSTFIDGGDFARIASRGYDAVRLQVPWYVFGEAGPMPGPSEGCLDY
VDRAFGWAEAAGIEVLLDVAVVPGTDSASPASFFGDAASFRRAVIDVAAALASRYAEREN
FLGIEPIGAIKGRSRRGLSVIEGVPPHLLRNFYRDAFEAVREAAGTRPVFVVNDAGLPDA
WRAFMSPARYENVWLDSHVFHYSDSMNAAGPTGVRRLVKDTEQYLARTKKSGLPVMVGEW
SSALPLADAGMTPEGRIALERVFTAGQMSAFSGCVGWFFQTWKTEGRLSSWDARVALSSF
EHGMLE

Enzyme Prediction     

No EC number prediction in MGYG000001213_01064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	13	258	1.7e-38	0.8642384105960265

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	3.27e-11	8	285	63	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	8.30e-04	24	240	30	236	Cellulase (glycosyl hydrolase family 5).
COG1625	NifB	0.010	67	180	169	261	Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH50588.1	5.45e-177	2	306	56	360
ADK68544.1	4.92e-110	7	305	46	346
BCV19183.1	6.97e-110	6	306	45	347
AKT48931.1	4.13e-106	6	305	45	345
SDR87855.1	8.57e-106	7	305	46	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	7.78e-24	2	283	38	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.01e-23	2	283	38	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
3N9K_A	2.00e-14	11	285	66	367	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1EQP_A	2.64e-14	11	285	61	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	2.64e-14	11	285	61	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D4Q5	3.59e-22	11	299	88	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
B0XN12	6.00e-21	11	299	88	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q4WK60	8.19e-21	11	299	88	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
A1CRV0	2.82e-20	11	299	88	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
B8N151	4.29e-19	11	292	77	382	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001213_01064.